Recombinant Full Length Human PPP1R1B Protein

• Cat.No.: PPP1R1B-390HF
• Product Overview: Recombinant full length Human DARPP32 with proprietary tag; Predicted MWt 43.89 including tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 168 amino acids
• Description: This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene.
• Form: Liquid
• Molecular Mass: 43.890kDa inclusive of tags
• AA Sequence: MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: PPP1R1B protein phosphatase 1, regulatory (inhibitor) subunit 1B [ Homo sapiens ]
• Official Symbol: PPP1R1B
• Synonyms: PPP1R1B; protein phosphatase 1, regulatory (inhibitor) subunit 1B; protein phosphatase 1 regulatory subunit 1B; DARPP 32; dopamine and cAMP regulated phosphoprotein; FLJ20940
• Gene ID: 84152
• mRNA Refseq: NM_001242464
• Protein Refseq: NP_001229393
• MIM: 604399
• UniProt ID: Q9UD71