Recombinant Human PPP1R1B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PPP1R1B-5421H |
Product Overview : | PPP1R1B MS Standard C13 and N15-labeled recombinant protein (NP_115568) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 22.8 kDa |
AA Sequence : | MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PPP1R1B protein phosphatase 1 regulatory inhibitor subunit 1B [ Homo sapiens (human) ] |
Official Symbol | PPP1R1B |
Synonyms | PPP1R1B; protein phosphatase 1, regulatory (inhibitor) subunit 1B (dopamine and cAMP regulated phosphoprotein, DARPP-32); DARPP 32; dopamine and cAMP regulated phosphoprotein; FLJ20940; DARPP-32; |
Gene ID | 84152 |
mRNA Refseq | NM_032192 |
Protein Refseq | NP_115568 |
MIM | 604399 |
UniProt ID | Q9UD71 |
◆ Recombinant Proteins | ||
PPP1R1B-390HF | Recombinant Full Length Human PPP1R1B Protein | +Inquiry |
Ppp1r1b-2634R | Recombinant Rat Ppp1r1b, Phosphorylated | +Inquiry |
PPP1R1B-2617H | Recombinant Human PPP1R1B Protein, His-tagged | +Inquiry |
PPP1R1B-7014M | Recombinant Mouse PPP1R1B Protein, His (Fc)-Avi-tagged | +Inquiry |
Ppp1r1b-5069M | Recombinant Mouse Ppp1r1b Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP1R1B-2939HCL | Recombinant Human PPP1R1B 293 Cell Lysate | +Inquiry |
PPP1R1B-2940HCL | Recombinant Human PPP1R1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP1R1B Products
Required fields are marked with *
My Review for All PPP1R1B Products
Required fields are marked with *