Recombinant Human PPP1R1B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PPP1R1B-5421H
Product Overview : PPP1R1B MS Standard C13 and N15-labeled recombinant protein (NP_115568) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 22.8 kDa
AA Sequence : MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PPP1R1B protein phosphatase 1 regulatory inhibitor subunit 1B [ Homo sapiens (human) ]
Official Symbol PPP1R1B
Synonyms PPP1R1B; protein phosphatase 1, regulatory (inhibitor) subunit 1B (dopamine and cAMP regulated phosphoprotein, DARPP-32); DARPP 32; dopamine and cAMP regulated phosphoprotein; FLJ20940; DARPP-32;
Gene ID 84152
mRNA Refseq NM_032192
Protein Refseq NP_115568
MIM 604399
UniProt ID Q9UD71

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP1R1B Products

Required fields are marked with *

My Review for All PPP1R1B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon