Recombinant Human PPP1R1B Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PPP1R1B-5421H | 
| Product Overview : | PPP1R1B MS Standard C13 and N15-labeled recombinant protein (NP_115568) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | DDK&Myc | 
| Description : | This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene. | 
| Molecular Mass : | 22.8 kDa | 
| AA Sequence : | MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGTTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
| Concentration : | 50 μg/mL as determined by BCA | 
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. | 
| Gene Name | PPP1R1B protein phosphatase 1 regulatory inhibitor subunit 1B [ Homo sapiens (human) ] | 
| Official Symbol | PPP1R1B | 
| Synonyms | PPP1R1B; protein phosphatase 1, regulatory (inhibitor) subunit 1B (dopamine and cAMP regulated phosphoprotein, DARPP-32); DARPP 32; dopamine and cAMP regulated phosphoprotein; FLJ20940; DARPP-32; | 
| Gene ID | 84152 | 
| mRNA Refseq | NM_032192 | 
| Protein Refseq | NP_115568 | 
| MIM | 604399 | 
| UniProt ID | Q9UD71 | 
| ◆ Recombinant Proteins | ||
| PPP1R1B-390HF | Recombinant Full Length Human PPP1R1B Protein | +Inquiry | 
| Ppp1r1b-5069M | Recombinant Mouse Ppp1r1b Protein, Myc/DDK-tagged | +Inquiry | 
| PPP1R1B-13229M | Recombinant Mouse PPP1R1B Protein | +Inquiry | 
| PPP1R1B-2617H | Recombinant Human PPP1R1B Protein, His-tagged | +Inquiry | 
| PPP1R1B-26806TH | Recombinant Human PPP1R1B | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| PPP1R1B-2939HCL | Recombinant Human PPP1R1B 293 Cell Lysate | +Inquiry | 
| PPP1R1B-2940HCL | Recombinant Human PPP1R1B 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP1R1B Products
Required fields are marked with *
My Review for All PPP1R1B Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            