Recombinant Human PPP1R1B protein, His-tagged
| Cat.No. : | PPP1R1B-6844H |
| Product Overview : | Recombinant Human PPP1R1B protein(Q9UD71)(1-168aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-168a.a. |
| Tag : | His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 23.2 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPP |
| Gene Name | PPP1R1B protein phosphatase 1, regulatory (inhibitor) subunit 1B (dopamine and cAMP regulated phosphoprotein, DARPP-32) [ Homo sapiens ] |
| Official Symbol | PPP1R1B |
| Synonyms | PPP1R1B; protein phosphatase 1, regulatory (inhibitor) subunit 1B (dopamine and cAMP regulated phosphoprotein, DARPP-32); DARPP 32; dopamine and cAMP regulated phosphoprotein; FLJ20940; DARPP-32; |
| Gene ID | 5503 |
| MIM | 604399 |
| UniProt ID | Q9UD71 |
| ◆ Recombinant Proteins | ||
| PPP1R1B-2118H | Recombinant Human PPP1R1B Protein (1-168 aa), GST-tagged | +Inquiry |
| PPP1R1B-2617H | Recombinant Human PPP1R1B Protein, His-tagged | +Inquiry |
| PPP1R1B-390HF | Recombinant Full Length Human PPP1R1B Protein | +Inquiry |
| PPP1R1B-3384R | Recombinant Rhesus Macaque PPP1R1B Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ppp1r1b-2634R | Recombinant Rat Ppp1r1b, Phosphorylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PPP1R1B-2940HCL | Recombinant Human PPP1R1B 293 Cell Lysate | +Inquiry |
| PPP1R1B-2939HCL | Recombinant Human PPP1R1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP1R1B Products
Required fields are marked with *
My Review for All PPP1R1B Products
Required fields are marked with *
