Recombinant Human PPP1R1B protein, His-tagged
Cat.No. : | PPP1R1B-6844H |
Product Overview : | Recombinant Human PPP1R1B protein(Q9UD71)(1-168aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-168a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 23.2 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPP |
Gene Name | PPP1R1B protein phosphatase 1, regulatory (inhibitor) subunit 1B (dopamine and cAMP regulated phosphoprotein, DARPP-32) [ Homo sapiens ] |
Official Symbol | PPP1R1B |
Synonyms | PPP1R1B; protein phosphatase 1, regulatory (inhibitor) subunit 1B (dopamine and cAMP regulated phosphoprotein, DARPP-32); DARPP 32; dopamine and cAMP regulated phosphoprotein; FLJ20940; DARPP-32; |
Gene ID | 5503 |
MIM | 604399 |
UniProt ID | Q9UD71 |
◆ Recombinant Proteins | ||
PPP1R1B-6844H | Recombinant Human PPP1R1B protein, His-tagged | +Inquiry |
PPP1R1B-26806TH | Recombinant Human PPP1R1B | +Inquiry |
PPP1R1B-5421H | Recombinant Human PPP1R1B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PPP1R1B-8531H | Recombinant Human PPP1R1B, His tagged | +Inquiry |
PPP1R1B-5038H | Recombinant Human PPP1R1B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP1R1B-2939HCL | Recombinant Human PPP1R1B 293 Cell Lysate | +Inquiry |
PPP1R1B-2940HCL | Recombinant Human PPP1R1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP1R1B Products
Required fields are marked with *
My Review for All PPP1R1B Products
Required fields are marked with *