Recombinant Human PPP1R2
| Cat.No. : | PPP1R2-29472TH |
| Product Overview : | Recombinant full length Human Protein phosphatase 1 inhibitor subunit 2 (amino acids 1-205) with N terminal proprietary tag; Predicted MWt 48.62 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 205 amino acids |
| Description : | Protein phosphatase inhibitor 2 is an enzyme that in humans is encoded by the PPP1R2 gene. |
| Molecular Weight : | 48.620kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEEL SKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYHSMMG DDEDACSDTEATEAMAPDILARKLAAAEGLEPKYRIQEQE SSGEEDSDLSPEEREKKRQFEMKRKLHYNEGLNIKLARQL ISKDLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQN KLRSS |
| Sequence Similarities : | Belongs to the protein phosphatase inhibitor 2 family. |
| Gene Name | PPP1R2 protein phosphatase 1, regulatory (inhibitor) subunit 2 [ Homo sapiens ] |
| Official Symbol | PPP1R2 |
| Synonyms | PPP1R2; protein phosphatase 1, regulatory (inhibitor) subunit 2; protein phosphatase inhibitor 2; IPP2; |
| Gene ID | 5504 |
| mRNA Refseq | NM_006241 |
| Protein Refseq | NP_006232 |
| MIM | 601792 |
| Uniprot ID | P41236 |
| Chromosome Location | 3q29 |
| Function | protein binding; protein serine/threonine phosphatase inhibitor activity; |
| ◆ Recombinant Proteins | ||
| PPP1R2-11693Z | Recombinant Zebrafish PPP1R2 | +Inquiry |
| PPP1R2-29472TH | Recombinant Human PPP1R2 | +Inquiry |
| PPP1R2-13231M | Recombinant Mouse PPP1R2 Protein | +Inquiry |
| PPP1R2-2967C | Recombinant Chicken PPP1R2 | +Inquiry |
| PPP1R2-391HF | Recombinant Full Length Human PPP1R2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PPP1R2-2937HCL | Recombinant Human PPP1R2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP1R2 Products
Required fields are marked with *
My Review for All PPP1R2 Products
Required fields are marked with *
