Recombinant Human PPP1R2
Cat.No. : | PPP1R2-29472TH |
Product Overview : | Recombinant full length Human Protein phosphatase 1 inhibitor subunit 2 (amino acids 1-205) with N terminal proprietary tag; Predicted MWt 48.62 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | Protein phosphatase inhibitor 2 is an enzyme that in humans is encoded by the PPP1R2 gene. |
Protein length : | 205 amino acids |
Molecular Weight : | 48.620kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEEL SKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYHSMMG DDEDACSDTEATEAMAPDILARKLAAAEGLEPKYRIQEQE SSGEEDSDLSPEEREKKRQFEMKRKLHYNEGLNIKLARQL ISKDLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQN KLRSS |
Sequence Similarities : | Belongs to the protein phosphatase inhibitor 2 family. |
Gene Name : | PPP1R2 protein phosphatase 1, regulatory (inhibitor) subunit 2 [ Homo sapiens ] |
Official Symbol : | PPP1R2 |
Synonyms : | PPP1R2; protein phosphatase 1, regulatory (inhibitor) subunit 2; protein phosphatase inhibitor 2; IPP2; |
Gene ID : | 5504 |
mRNA Refseq : | NM_006241 |
Protein Refseq : | NP_006232 |
MIM : | 601792 |
Uniprot ID : | P41236 |
Chromosome Location : | 3q29 |
Function : | protein binding; protein serine/threonine phosphatase inhibitor activity; |
Products Types
◆ Recombinant Protein | ||
Ppp1r2-5071M | Recombinant Mouse Ppp1r2 Protein, Myc/DDK-tagged | +Inquiry |
PPP1R2-4281R | Recombinant Rat PPP1R2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP1R2-7016M | Recombinant Mouse PPP1R2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP1R2-3385R | Recombinant Rhesus Macaque PPP1R2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP1R2-2967C | Recombinant Chicken PPP1R2 | +Inquiry |
◆ Lysates | ||
PPP1R2-2937HCL | Recombinant Human PPP1R2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket