Recombinant Human PPP1R35 Protein, GST-tagged

Cat.No. : PPP1R35-5240H
Product Overview : Human C7orf47 full-length ORF ( NP_659467.1, 1 a.a. - 253 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : PPP1R35 (Protein Phosphatase 1 Regulatory Subunit 35) is a Protein Coding gene. GO annotations related to this gene include phosphatase binding and protein phosphatase inhibitor activity.
Molecular Mass : 54.4 kDa
AA Sequence : MMMGCGESELKSADGEEAAAVPGPPPEPQVPQLRAPVPEPGLDLSLSPRPDSPQPRHGSPGRRKGRAERRGAARQRRQVRFRLTPPSPVRSEPQPAVPQELEMPVLKSSLALGLELRAAAGSHFDAAKAVEEQLRKSFQIRCGLEESVSEGLNVPRSKRLFRDLVSLQVPEEQVLNAALREKLALLPPQARAPHPKEPPGPGPDMTILCDPETLFYESPHLTLDGLPPLRLQLRPRPSEDTFLMHRTLRRWEA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PPP1R35 protein phosphatase 1 regulatory subunit 35 [ Homo sapiens (human) ]
Official Symbol PPP1R35
Synonyms C7orf47; PPP1R35; protein phosphatase 1 regulatory subunit 35; protein phosphatase 1 regulatory subunit 35; UPF0683 protein C7orf47
Gene ID 221908
mRNA Refseq NM_001346938
Protein Refseq NP_001333867
UniProt ID Q8TAP8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP1R35 Products

Required fields are marked with *

My Review for All PPP1R35 Products

Required fields are marked with *

0
cart-icon
0
compare icon