Recombinant Human PPP1R3A

Cat.No. : PPP1R3A-31051TH
Product Overview : Recombinant fragment of Human PPP1R3A with an N terminal proprietary tag; Predicted MWt 36.52 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 99 amino acids
Description : The glycogen-associated form of protein phosphatase-1 (PP1) derived from skeletal muscle is a heterodimer composed of a 37-kD catalytic subunit and a 124-kD targeting and regulatory subunit. This gene encodes the regulatory subunit which binds to muscle glycogen with high affinity, thereby enhancing dephosphorylation of glycogen-bound substrates for PP1 such as glycogen synthase and glycogen phosphorylase kinase.
Molecular Weight : 36.520kDa inclusive of tags
Tissue specificity : Skeletal muscle and heart.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSEDIYLDTPSSGTRRVSFADSFGFNLVSVKEFDCWELPSASTTFDLGTDIFHT
Sequence Similarities : Contains 1 CBM21 (carbohydrate binding type-21) domain.
Gene Name PPP1R3A protein phosphatase 1, regulatory subunit 3A [ Homo sapiens ]
Official Symbol PPP1R3A
Synonyms PPP1R3A; protein phosphatase 1, regulatory subunit 3A; PPP1R3, protein phosphatase 1, regulatory (inhibitor) subunit 3A , protein phosphatase 1, regulatory (inhibitor) subunit 3A (glycogen and sarcoplasmic reticulum binding subunit, skeletal muscle); pr
Gene ID 5506
mRNA Refseq NM_002711
Protein Refseq NP_002702
MIM 600917
Uniprot ID Q16821
Chromosome Location 7q31.1
Pathway Insulin Signaling, organism-specific biosystem; Insulin signaling pathway, organism-specific biosystem; Insulin signaling pathway, conserved biosystem; Insulin-mediated glucose transport, organism-specific biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP1R3A Products

Required fields are marked with *

My Review for All PPP1R3A Products

Required fields are marked with *

0
cart-icon