Recombinant Human PPP1R3G protein, His&Myc-tagged
Cat.No. : | PPP1R3G-4533H |
Product Overview : | Recombinant Human PPP1R3G protein(B7ZBB8)(1-358aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-358aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 45.5 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MEPIGARLSLEAPGPAPFREAPPAEELPAPVVPCVQGGGDGGGASETPSPDAQLGDRPLSPKEEAAPQEQEELLECRRRCRARSFSLPADPILQAAKFLQQQQQQAVALGGEGAEDAQLGPGGCCAKCKKRVQFADTLGLSLASVKHFSEAEEPQVPPAVLSRLRSFPMRAEDLEQLGGLLAAAAVAAPLSAPPSRLRPLFQLPGPSAAAERLQRQRVCLERVQCSTASGAEVKGSGRVLSCPGPRAVTVRYTFTEWRSFLDVPAELQPEPLEPQQPEAPSGASEPGSGDAKKEPGAECFHFSLCLPPGLQPEDEEDADERGVAVHFAVCYRCAQGEYWDNNAGANYTLRYARPADAL |
Gene Name | PPP1R3G protein phosphatase 1, regulatory subunit 3G [ Homo sapiens ] |
Official Symbol | PPP1R3G |
Synonyms | PPP1R3G; protein phosphatase 1, regulatory subunit 3G; protein phosphatase 1, regulatory (inhibitor) subunit 3G; putative protein phosphatase 1 regulatory inhibitor subunit 3G; |
Gene ID | 648791 |
mRNA Refseq | NM_001145115 |
Protein Refseq | NP_001138587 |
UniProt ID | B7ZBB8 |
◆ Recombinant Proteins | ||
PPP1R3G-1839H | Recombinant Human PPP1R3G Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Ppp1r3g-5074M | Recombinant Mouse Ppp1r3g Protein, Myc/DDK-tagged | +Inquiry |
PPP1R3G-4533H | Recombinant Human PPP1R3G protein, His&Myc-tagged | +Inquiry |
PPP1R3G-7025M | Recombinant Mouse PPP1R3G Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP1R3G-13243M | Recombinant Mouse PPP1R3G Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP1R3G Products
Required fields are marked with *
My Review for All PPP1R3G Products
Required fields are marked with *