Recombinant Human PPP1R7 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: PPP1R7-184H
• Product Overview: PPP1R7 MS Standard C13 and N15-labeled recombinant protein (NP_002703) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a protein subunit that regulates the activity of the serine/threonine phosphatase, protein phosphatase-1. The encoded protein is required for completion of the mitotic cycle and for targeting protein phosphatase-1 to mitotic kinetochores. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]
• Molecular Mass: 41.6 kDa
• AA Sequence: MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPEEEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATFVRFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PPP1R7 protein phosphatase 1, regulatory subunit 7 [ Homo sapiens (human) ]
• Official Symbol: PPP1R7
• Synonyms: PPP1R7; protein phosphatase 1, regulatory subunit 7; protein phosphatase 1, regulatory (inhibitor) subunit 7; protein phosphatase 1 regulatory subunit 7; sds22; protein phosphatase 1 regulatory subunit 22; protein phosphatase-1 regulatory subunit 7 beta1; protein phosphatase-1 regulatory subunit 7 beta2; protein phosphatase-1 regulatory subunit 7 alpha2; SDS22
• Gene ID: 5510
• mRNA Refseq: NM_002712
• Protein Refseq: NP_002703
• MIM: 602877
• UniProt ID: Q15435