Recombinant Human PPP1R7 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : PPP1R7-184H
Product Overview : PPP1R7 MS Standard C13 and N15-labeled recombinant protein (NP_002703) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein subunit that regulates the activity of the serine/threonine phosphatase, protein phosphatase-1. The encoded protein is required for completion of the mitotic cycle and for targeting protein phosphatase-1 to mitotic kinetochores. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]
Molecular Mass : 41.6 kDa
AA Sequence : MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPEEEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATFVRFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PPP1R7 protein phosphatase 1, regulatory subunit 7 [ Homo sapiens (human) ]
Official Symbol PPP1R7
Synonyms PPP1R7; protein phosphatase 1, regulatory subunit 7; protein phosphatase 1, regulatory (inhibitor) subunit 7; protein phosphatase 1 regulatory subunit 7; sds22; protein phosphatase 1 regulatory subunit 22; protein phosphatase-1 regulatory subunit 7 beta1; protein phosphatase-1 regulatory subunit 7 beta2; protein phosphatase-1 regulatory subunit 7 alpha2; SDS22;
Gene ID 5510
mRNA Refseq NM_002712
Protein Refseq NP_002703
MIM 602877
UniProt ID Q15435

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP1R7 Products

Required fields are marked with *

My Review for All PPP1R7 Products

Required fields are marked with *

0
cart-icon
0
compare icon