Recombinant Human PPP1R7 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | PPP1R7-184H |
Product Overview : | PPP1R7 MS Standard C13 and N15-labeled recombinant protein (NP_002703) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein subunit that regulates the activity of the serine/threonine phosphatase, protein phosphatase-1. The encoded protein is required for completion of the mitotic cycle and for targeting protein phosphatase-1 to mitotic kinetochores. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013] |
Molecular Mass : | 41.6 kDa |
AA Sequence : | MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPEEEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATFVRFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PPP1R7 protein phosphatase 1, regulatory subunit 7 [ Homo sapiens (human) ] |
Official Symbol | PPP1R7 |
Synonyms | PPP1R7; protein phosphatase 1, regulatory subunit 7; protein phosphatase 1, regulatory (inhibitor) subunit 7; protein phosphatase 1 regulatory subunit 7; sds22; protein phosphatase 1 regulatory subunit 22; protein phosphatase-1 regulatory subunit 7 beta1; protein phosphatase-1 regulatory subunit 7 beta2; protein phosphatase-1 regulatory subunit 7 alpha2; SDS22; |
Gene ID | 5510 |
mRNA Refseq | NM_002712 |
Protein Refseq | NP_002703 |
MIM | 602877 |
UniProt ID | Q15435 |
◆ Recombinant Proteins | ||
Ppp1r7-5075M | Recombinant Mouse Ppp1r7 Protein, Myc/DDK-tagged | +Inquiry |
PPP1R7-4287R | Recombinant Rat PPP1R7 Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP1R7-4628R | Recombinant Rat PPP1R7 Protein | +Inquiry |
PPP1R7-3511Z | Recombinant Zebrafish PPP1R7 | +Inquiry |
PPP1R7-1912H | Recombinant Human PPP1R7, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP1R7-2933HCL | Recombinant Human PPP1R7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP1R7 Products
Required fields are marked with *
My Review for All PPP1R7 Products
Required fields are marked with *
0
Inquiry Basket