Recombinant Human PPP1R9B Protein, His tagged
| Cat.No. : | PPP1R9B-001H |
| Product Overview : | Recombinant Human PPP1R9B Protein with His tag was expressed in E. coli. |
| Availability | February 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 289-412 aa |
| Description : | This gene encodes a scaffold protein that functions as a regulatory subunit of protein phosphatase 1a. Expression of this gene is particularly high in dendritic spines, suggesting that the encoded protein may play a role in receiving signals from the central nervous system. The encoded protein has putative tumor suppressor function and decreased expression has been observed in tumors. |
| Tag : | C-His |
| Molecular Mass : | 14 kDa |
| AA Sequence : | MPPKPREVRKIKPVEVEESGESEAESAPGEVIQAEVTVHAALENGSTVATAASPAPEEPKAQAAPEKEAAAVAPPERGVGNGRAPDVAPEEVDESKKEDFSEADLVDVSAYSGLGEDSAGSALEEHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 80% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4 |
| Concentration : | 1 mg/mL by BCA |
| Gene Name | PPP1R9B protein phosphatase 1 regulatory subunit 9B [ Homo sapiens (human) ] |
| Official Symbol | PPP1R9B |
| Synonyms | PPP1R9B; protein phosphatase 1 regulatory subunit 9B; Spn; SPINO; PPP1R6; PPP1R9; neurabin-2; neurabin-II; protein phosphatase 1, regulatory (inhibitor) subunit 9B; protein phosphatase 1, regulatory subunit 9B, spinophilin |
| Gene ID | 84687 |
| mRNA Refseq | NM_032595 |
| Protein Refseq | NP_115984 |
| MIM | 603325 |
| UniProt ID | Q96SB3 |
| ◆ Recombinant Proteins | ||
| PPP1R9B-13248M | Recombinant Mouse PPP1R9B Protein | +Inquiry |
| PPP1R9B-7028M | Recombinant Mouse PPP1R9B Protein, His (Fc)-Avi-tagged | +Inquiry |
| PPP1R9B-6485C | Recombinant Chicken PPP1R9B | +Inquiry |
| PPP1R9B-001H | Recombinant Human PPP1R9B Protein, His tagged | +Inquiry |
| PPP1R9B-4630R | Recombinant Rat PPP1R9B Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP1R9B Products
Required fields are marked with *
My Review for All PPP1R9B Products
Required fields are marked with *
