Recombinant Human PPP2CA protein, GST-tagged
Cat.No. : | PPP2CA-27617TH |
Product Overview : | Recombinant Human PPP2CA(1 a.a. - 309 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-309 a.a. |
Description : | This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes an alpha isoform of the catalytic subunit. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 62 kDa |
AA Sequence : | MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | PPP2CA protein phosphatase 2, catalytic subunit, alpha isozyme [ Homo sapiens ] |
Official Symbol | PPP2CA |
Synonyms | PPP2CA; protein phosphatase 2, catalytic subunit, alpha isozyme; protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform; serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; PP2Calpha; protein phosphatase 2A catalytic subunit; alpha isoform; PP2A-alpha; replication protein C; protein phosphatase 2A catalytic subunit, alpha isoform; serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform; RP-C; PP2Ac; PP2CA; |
Gene ID | 5515 |
mRNA Refseq | NM_002715 |
Protein Refseq | NP_002706 |
MIM | 176915 |
UniProt ID | P67775 |
Chromosome Location | 5q31.1 |
Pathway | Activated TLR4 signalling, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Beta-catenin phosphorylation cascade, organism-specific biosystem; C-MYC pathway, organism-specific biosystem; CTLA4 inhibitory signaling, organism-specific biosystem; Canonical Wnt signaling pathway, organism-specific biosystem; Cell Cycle, organism-specific biosystem; |
Function | hydrolase activity; metal ion binding; phosphoprotein phosphatase activity; protein C-terminus binding; protein binding; protein dimerization activity; |
◆ Recombinant Proteins | ||
PPP2CA-4290R | Recombinant Rat PPP2CA Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP2CA-577HFL | Recombinant Full Length Human PPP2CA Protein, C-Flag-tagged | +Inquiry |
PPP2CA-1304C | Recombinant Chicken PPP2CA | +Inquiry |
PPP2CA-409HF | Recombinant Full Length Human PPP2CA Protein, GST-tagged | +Inquiry |
PPP2CA-4631R | Recombinant Rat PPP2CA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP2CA-2929HCL | Recombinant Human PPP2CA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP2CA Products
Required fields are marked with *
My Review for All PPP2CA Products
Required fields are marked with *
0
Inquiry Basket