Recombinant Human PPP2CB
| Cat.No. : | PPP2CB-27931TH |
| Product Overview : | Recombinant full length Human PPP2CB withan N terminal proprietary tag; Predicted MWt 59.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 309 amino acids |
| Description : | This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes a beta isoform of the catalytic subunit. |
| Molecular Weight : | 59.730kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILT KESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNY LFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVD GQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLW SDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDD TLKYSFLQFDPAPRRGEPHVTRRTPDYFL |
| Sequence Similarities : | Belongs to the PPP phosphatase family. PP-1 subfamily. |
| Gene Name | PPP2CB protein phosphatase 2, catalytic subunit, beta isozyme [ Homo sapiens ] |
| Official Symbol | PPP2CB |
| Synonyms | PPP2CB; protein phosphatase 2, catalytic subunit, beta isozyme; protein phosphatase 2 (formerly 2A), catalytic subunit, beta isoform; serine/threonine-protein phosphatase 2A catalytic subunit beta isoform; PP2Abeta; protein phosphatase 2A catalytic subuni |
| Gene ID | 5516 |
| mRNA Refseq | NM_001009552 |
| Protein Refseq | NP_001009552 |
| MIM | 176916 |
| Uniprot ID | P62714 |
| Chromosome Location | 8p12 |
| Pathway | Activated TLR4 signalling, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Beta-catenin phosphorylation cascade, organism-specific biosystem; CTLA4 inhibitory signaling, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; |
| Function | hydrolase activity; metal ion binding; protein C-terminus binding; protein binding; contributes_to protein serine/threonine phosphatase activity; |
| ◆ Recombinant Proteins | ||
| PPP2CB-650H | Recombinant Human PPP2CB Protein, His-tagged | +Inquiry |
| PPP2CB-3388R | Recombinant Rhesus Macaque PPP2CB Protein, His (Fc)-Avi-tagged | +Inquiry |
| PPP2CB-12481Z | Recombinant Zebrafish PPP2CB | +Inquiry |
| PPP2CB-6681C | Recombinant Chicken PPP2CB | +Inquiry |
| PPP2CB-3570R | Recombinant Rhesus monkey PPP2CB Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PPP2CB-2928HCL | Recombinant Human PPP2CB 293 Cell Lysate | +Inquiry |
| PPP2CB-2927HCL | Recombinant Human PPP2CB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP2CB Products
Required fields are marked with *
My Review for All PPP2CB Products
Required fields are marked with *
