Recombinant Human PPP2R1A, His-tagged

Cat.No. : PPP2R1A-27571TH
Product Overview : Recombinant fragment, corresponding to amino acids 280-583 of Human PPP2R1A with N terminal His tag, 304 amino acids, 35kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 280-583 a.a.
Description : This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. This gene encodes an alpha isoform of the constant regulatory subunit A. Alternatively spliced transcript variants have been described.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 96 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRE NVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILG KDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVI GIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQ LGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKF GKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEV CGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGP ILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEAL
Gene Name PPP2R1A protein phosphatase 2, regulatory subunit A, alpha [ Homo sapiens ]
Official Symbol PPP2R1A
Synonyms PPP2R1A; protein phosphatase 2, regulatory subunit A, alpha; protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform , protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform; serine/threonine-protein phosphatase
Gene ID 5518
mRNA Refseq NM_014225
Protein Refseq NP_055040
MIM 605983
Uniprot ID P30153
Chromosome Location 19q13
Pathway Activated TLR4 signalling, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Beta-catenin phosphorylation cascade, organism-specific biosystem; CTLA4 inhibitory signaling, organism-specific biosystem; Canonical Wnt signaling pathway, organism-specific biosystem;
Function antigen binding; protein binding; protein heterodimerization activity; protein phosphatase type 2A regulator activity; protein serine/threonine phosphatase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP2R1A Products

Required fields are marked with *

My Review for All PPP2R1A Products

Required fields are marked with *

0
cart-icon