Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human PPP2R1A, His-tagged

Cat.No. : PPP2R1A-27571TH
Product Overview : Recombinant fragment, corresponding to amino acids 280-583 of Human PPP2R1A with N terminal His tag, 304 amino acids, 35kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. This gene encodes an alpha isoform of the constant regulatory subunit A. Alternatively spliced transcript variants have been described.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 96 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRE NVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILG KDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVI GIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQ LGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKF GKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEV CGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGP ILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEAL
Gene Name : PPP2R1A protein phosphatase 2, regulatory subunit A, alpha [ Homo sapiens ]
Official Symbol : PPP2R1A
Synonyms : PPP2R1A; protein phosphatase 2, regulatory subunit A, alpha; protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform , protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform; serine/threonine-protein phosphatase
Gene ID : 5518
mRNA Refseq : NM_014225
Protein Refseq : NP_055040
MIM : 605983
Uniprot ID : P30153
Chromosome Location : 19q13
Pathway : Activated TLR4 signalling, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Beta-catenin phosphorylation cascade, organism-specific biosystem; CTLA4 inhibitory signaling, organism-specific biosystem; Canonical Wnt signaling pathway, organism-specific biosystem;
Function : antigen binding; protein binding; protein heterodimerization activity; protein phosphatase type 2A regulator activity; protein serine/threonine phosphatase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends