Recombinant Human PPP2R3B Protein (1-176 aa), His-SUMO-tagged

Cat.No. : PPP2R3B-1165H
Product Overview : Recombinant Human PPP2R3B Protein (1-176 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Isoform 2.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-176 aa
Description : The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 36.1 kDa
AA Sequence : MDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name PPP2R3B protein phosphatase 2, regulatory subunit B, beta [ Homo sapiens ]
Official Symbol PPP2R3B
Synonyms PPP2R3B; PPP2R3LY; PR48; NYREN8; PPP2R3L; FLJ60425;
Gene ID 28227
mRNA Refseq NM_013239
Protein Refseq NP_037371
MIM 300339
UniProt ID Q9Y5P8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP2R3B Products

Required fields are marked with *

My Review for All PPP2R3B Products

Required fields are marked with *

0
cart-icon
0
compare icon