Recombinant Human PPP2R4, His-tagged

Cat.No. : PPP2R4-27572TH
Product Overview : Recombinant fragment, corresponding to amino acids 104-323 of Human PPP2R4 Isoform 1 with an N-terminal His tag; Predicted MWt 26 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Protein phosphatase 2A is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2A holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B/PR61, and B/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B family. This gene encodes a specific phosphotyrosyl phosphatase activator of the dimeric form of protein phosphatase 2A. Alternative splicing results in multiple transcript variants encoding different isoforms.
Conjugation : HIS
Source : E. coli
Tissue specificity : Widely expressed.
Form : Lyophilised:Reconstitute with 125 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : AYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESV GNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIV FKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLP FIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECI LFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKA ECLEKFPVIQHFKFGSLLPIHPVTSG
Sequence Similarities : Belongs to the PTPA-type PPIase family.
Protein length : 104-323
Gene Name : PPP2R4 protein phosphatase 2A activator, regulatory subunit 4 [ Homo sapiens ]
Official Symbol : PPP2R4
Synonyms : PPP2R4; protein phosphatase 2A activator, regulatory subunit 4; protein phosphatase 2A, regulatory subunit B (PR 53); serine/threonine-protein phosphatase 2A activator; phosphotyrosyl phosphatase activator; PP2A phosphatase activator; PR53; PTPA;
Gene ID : 5524
mRNA Refseq : NM_001193397
Protein Refseq : NP_001180326
MIM : 600756
Uniprot ID : Q15257
Chromosome Location : 9q34
Pathway : Glycogen Metabolism, organism-specific biosystem; IL-6 Signaling Pathway, organism-specific biosystem; Validated targets of C-MYC transcriptional repression, organism-specific biosystem; Wnt Signaling Pathway and Pluripotency, organism-specific biosystem; p53 pathway, organism-specific biosystem;
Function : ATP binding; contributes_to ATPase activity; isomerase activity; nucleotide binding; peptidyl-prolyl cis-trans isomerase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PPP2R4 Products

Required fields are marked with *

My Review for All PPP2R4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /
  • Service lnquiry:

Stay Updated on the Latest Bioscience Trends