Recombinant Human PPP2R4, His-tagged
Cat.No. : | PPP2R4-27572TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 104-323 of Human PPP2R4 Isoform 1 with an N-terminal His tag; Predicted MWt 26 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 104-323 a.a. |
Description : | Protein phosphatase 2A is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2A holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B/PR61, and B/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B family. This gene encodes a specific phosphotyrosyl phosphatase activator of the dimeric form of protein phosphatase 2A. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Conjugation : | HIS |
Tissue specificity : | Widely expressed. |
Form : | Lyophilised:Reconstitute with 125 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESV GNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIV FKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLP FIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECI LFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKA ECLEKFPVIQHFKFGSLLPIHPVTSG |
Sequence Similarities : | Belongs to the PTPA-type PPIase family. |
Gene Name | PPP2R4 protein phosphatase 2A activator, regulatory subunit 4 [ Homo sapiens ] |
Official Symbol | PPP2R4 |
Synonyms | PPP2R4; protein phosphatase 2A activator, regulatory subunit 4; protein phosphatase 2A, regulatory subunit B (PR 53); serine/threonine-protein phosphatase 2A activator; phosphotyrosyl phosphatase activator; PP2A phosphatase activator; PR53; PTPA; |
Gene ID | 5524 |
mRNA Refseq | NM_001193397 |
Protein Refseq | NP_001180326 |
MIM | 600756 |
Uniprot ID | Q15257 |
Chromosome Location | 9q34 |
Pathway | Glycogen Metabolism, organism-specific biosystem; IL-6 Signaling Pathway, organism-specific biosystem; Validated targets of C-MYC transcriptional repression, organism-specific biosystem; Wnt Signaling Pathway and Pluripotency, organism-specific biosystem; p53 pathway, organism-specific biosystem; |
Function | ATP binding; contributes_to ATPase activity; isomerase activity; nucleotide binding; peptidyl-prolyl cis-trans isomerase activity; |
◆ Recombinant Proteins | ||
PPP2R4-7037M | Recombinant Mouse PPP2R4 Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP2R4-13260M | Recombinant Mouse PPP2R4 Protein | +Inquiry |
PPP2R4-3022C | Recombinant Chicken PPP2R4 | +Inquiry |
PPP2R4-878Z | Recombinant Zebrafish PPP2R4 | +Inquiry |
PPP2R4-27572TH | Recombinant Human PPP2R4, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP2R4-2919HCL | Recombinant Human PPP2R4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP2R4 Products
Required fields are marked with *
My Review for All PPP2R4 Products
Required fields are marked with *