Recombinant Human PPP2R4, His-tagged

Cat.No. : PPP2R4-27572TH
Product Overview : Recombinant fragment, corresponding to amino acids 104-323 of Human PPP2R4 Isoform 1 with an N-terminal His tag; Predicted MWt 26 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 104-323 a.a.
Description : Protein phosphatase 2A is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2A holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B/PR61, and B/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B family. This gene encodes a specific phosphotyrosyl phosphatase activator of the dimeric form of protein phosphatase 2A. Alternative splicing results in multiple transcript variants encoding different isoforms.
Conjugation : HIS
Tissue specificity : Widely expressed.
Form : Lyophilised:Reconstitute with 125 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : AYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESV GNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIV FKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLP FIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECI LFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKA ECLEKFPVIQHFKFGSLLPIHPVTSG
Sequence Similarities : Belongs to the PTPA-type PPIase family.
Gene Name PPP2R4 protein phosphatase 2A activator, regulatory subunit 4 [ Homo sapiens ]
Official Symbol PPP2R4
Synonyms PPP2R4; protein phosphatase 2A activator, regulatory subunit 4; protein phosphatase 2A, regulatory subunit B (PR 53); serine/threonine-protein phosphatase 2A activator; phosphotyrosyl phosphatase activator; PP2A phosphatase activator; PR53; PTPA;
Gene ID 5524
mRNA Refseq NM_001193397
Protein Refseq NP_001180326
MIM 600756
Uniprot ID Q15257
Chromosome Location 9q34
Pathway Glycogen Metabolism, organism-specific biosystem; IL-6 Signaling Pathway, organism-specific biosystem; Validated targets of C-MYC transcriptional repression, organism-specific biosystem; Wnt Signaling Pathway and Pluripotency, organism-specific biosystem; p53 pathway, organism-specific biosystem;
Function ATP binding; contributes_to ATPase activity; isomerase activity; nucleotide binding; peptidyl-prolyl cis-trans isomerase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP2R4 Products

Required fields are marked with *

My Review for All PPP2R4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon