Recombinant Human PPP2R4, His-tagged
Cat.No. : | PPP2R4-27572TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 104-323 of Human PPP2R4 Isoform 1 with an N-terminal His tag; Predicted MWt 26 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Protein phosphatase 2A is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2A holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B/PR61, and B/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B family. This gene encodes a specific phosphotyrosyl phosphatase activator of the dimeric form of protein phosphatase 2A. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Widely expressed. |
Form : | Lyophilised:Reconstitute with 125 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESV GNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIV FKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLP FIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECI LFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKA ECLEKFPVIQHFKFGSLLPIHPVTSG |
Sequence Similarities : | Belongs to the PTPA-type PPIase family. |
Protein length : | 104-323 |
Gene Name : | PPP2R4 protein phosphatase 2A activator, regulatory subunit 4 [ Homo sapiens ] |
Official Symbol : | PPP2R4 |
Synonyms : | PPP2R4; protein phosphatase 2A activator, regulatory subunit 4; protein phosphatase 2A, regulatory subunit B (PR 53); serine/threonine-protein phosphatase 2A activator; phosphotyrosyl phosphatase activator; PP2A phosphatase activator; PR53; PTPA; |
Gene ID : | 5524 |
mRNA Refseq : | NM_001193397 |
Protein Refseq : | NP_001180326 |
MIM : | 600756 |
Uniprot ID : | Q15257 |
Chromosome Location : | 9q34 |
Pathway : | Glycogen Metabolism, organism-specific biosystem; IL-6 Signaling Pathway, organism-specific biosystem; Validated targets of C-MYC transcriptional repression, organism-specific biosystem; Wnt Signaling Pathway and Pluripotency, organism-specific biosystem; p53 pathway, organism-specific biosystem; |
Function : | ATP binding; contributes_to ATPase activity; isomerase activity; nucleotide binding; peptidyl-prolyl cis-trans isomerase activity; |
Products Types
◆ Recombinant Protein | ||
PPP2R4-7037M | Recombinant Mouse PPP2R4 Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP2R4-3022C | Recombinant Chicken PPP2R4 | +Inquiry |
PPP2R4-589H | Recombinant Human PPP2R4 | +Inquiry |
PPP2R4-13260M | Recombinant Mouse PPP2R4 Protein | +Inquiry |
PPP2R4-878Z | Recombinant Zebrafish PPP2R4 | +Inquiry |
◆ Lysates | ||
PPP2R4-2919HCL | Recombinant Human PPP2R4 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PPP2R4 Products
Required fields are marked with *
My Review for All PPP2R4 Products
Required fields are marked with *
0
Inquiry Basket