Recombinant Human PPP2R5B protein, GST-tagged

Cat.No. : PPP2R5B-3704H
Product Overview : Recombinant Human PPP2R5B protein(51-106 aa), fused to GST tag, was expressed in E. coli.
Availability November 28, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 51-106 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : RYQSNQQELTPLPLLKDVPASELHELLSRKLAQCGVMFDFLDCVADLKGKEVKRAA
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PPP2R5B protein phosphatase 2, regulatory subunit B, beta [ Homo sapiens ]
Official Symbol PPP2R5B
Synonyms PPP2R5B; protein phosphatase 2, regulatory subunit B, beta; protein phosphatase 2, regulatory subunit B (B56), beta isoform , protein phosphatase 2, regulatory subunit B, beta isoform; serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform; B56B; FLJ35411; PP2A; B subunit; B beta isoform; B56 beta isoform; PR61 beta isoform; R5 beta isoform; PR61B; serine/threonine protein phosphatase 2A; 56 kDa regulatory subunit; beta isoform; PP2A B subunit isoform B-beta; PP2A B subunit isoform R5-beta; PP2A B subunit isoform B56-beta; PP2A B subunit isoform PR61-beta; protein phosphatase 2, regulatory subunit B, beta isoform; serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, beta isoform;
Gene ID 5526
mRNA Refseq NM_006244
Protein Refseq NP_006235
MIM 601644
UniProt ID Q15173

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP2R5B Products

Required fields are marked with *

My Review for All PPP2R5B Products

Required fields are marked with *

0
cart-icon
0
compare icon