Recombinant Human PPP2R5B protein, GST-tagged

• Cat.No.: PPP2R5B-3704H
• Product Overview: Recombinant Human PPP2R5B protein(51-106 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 51-106 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: RYQSNQQELTPLPLLKDVPASELHELLSRKLAQCGVMFDFLDCVADLKGKEVKRAA
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PPP2R5B protein phosphatase 2, regulatory subunit B, beta [ Homo sapiens ]
• Official Symbol: PPP2R5B
• Synonyms: PPP2R5B; protein phosphatase 2, regulatory subunit B, beta; protein phosphatase 2, regulatory subunit B (B56), beta isoform , protein phosphatase 2, regulatory subunit B, beta isoform; serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform; B56B; FLJ35411; PP2A; B subunit; B beta isoform; B56 beta isoform; PR61 beta isoform; R5 beta isoform; PR61B; serine/threonine protein phosphatase 2A; 56 kDa regulatory subunit; beta isoform; PP2A B subunit isoform B-beta; PP2A B subunit isoform R5-beta; PP2A B subunit isoform B56-beta; PP2A B subunit isoform PR61-beta; protein phosphatase 2, regulatory subunit B, beta isoform; serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, beta isoform
• Gene ID: 5526
• mRNA Refseq: NM_006244
• Protein Refseq: NP_006235
• MIM: 601644
• UniProt ID: Q15173