Recombinant Human PPP3CA, His-tagged
| Cat.No. : | PPP3CA-26743TH |
| Product Overview : | Recombinant full length Human Calcineurin A Isoform 2 with an N terminal His tag; 534 amino acids with tag, MWt 60.0 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 511 amino acids |
| Conjugation : | HIS |
| Molecular Weight : | 60.000kDa inclusive of tags |
| Form : | Liquid |
| Purity : | by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, 1mM EDTA, pH 8.0 |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHTGSMSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ |
| Sequence Similarities : | Belongs to the PPP phosphatase family. PP-2B subfamily. |
| Gene Name | PPP3CA protein phosphatase 3, catalytic subunit, alpha isozyme [ Homo sapiens ] |
| Official Symbol | PPP3CA |
| Synonyms | PPP3CA; protein phosphatase 3, catalytic subunit, alpha isozyme; CALN, CALNA, protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform , protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform (calcineurin A alpha); serine/thr |
| Gene ID | 5530 |
| mRNA Refseq | NM_000944 |
| Protein Refseq | NP_000935 |
| MIM | 114105 |
| Uniprot ID | Q08209 |
| Chromosome Location | 4q24 |
| Pathway | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; Apoptosis, organism-specific biosystem; |
| Function | calcium ion binding; calcium-dependent protein serine/threonine phosphatase activity; calmodulin binding; hydrolase activity; protein binding; |
| ◆ Recombinant Proteins | ||
| PPP3CA-158H | Recombinant Human PPP3CA | +Inquiry |
| PPP3CA-1922H | Recombinant Human PPP3CA, GST-tagged | +Inquiry |
| PPP3CA-4298R | Recombinant Rat PPP3CA Protein, His (Fc)-Avi-tagged | +Inquiry |
| IL13RA2-618HF | Active Recombinant Human IL13RA2 Protein, Fc-tagged, FITC conjugated | +Inquiry |
| PPP3CA-4639R | Recombinant Rat PPP3CA Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PPP3CA-001HCL | Recombinant Human PPP3CA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP3CA Products
Required fields are marked with *
My Review for All PPP3CA Products
Required fields are marked with *
