Recombinant Human PPP3CA, His-tagged

Cat.No. : PPP3CA-26743TH
Product Overview : Recombinant full length Human Calcineurin A Isoform 2 with an N terminal His tag; 534 amino acids with tag, MWt 60.0 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 511 amino acids
Conjugation : HIS
Molecular Weight : 60.000kDa inclusive of tags
Form : Liquid
Purity : by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, 1mM EDTA, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHTGSMSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ
Sequence Similarities : Belongs to the PPP phosphatase family. PP-2B subfamily.
Gene Name PPP3CA protein phosphatase 3, catalytic subunit, alpha isozyme [ Homo sapiens ]
Official Symbol PPP3CA
Synonyms PPP3CA; protein phosphatase 3, catalytic subunit, alpha isozyme; CALN, CALNA, protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform , protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform (calcineurin A alpha); serine/thr
Gene ID 5530
mRNA Refseq NM_000944
Protein Refseq NP_000935
MIM 114105
Uniprot ID Q08209
Chromosome Location 4q24
Pathway Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; Apoptosis, organism-specific biosystem;
Function calcium ion binding; calcium-dependent protein serine/threonine phosphatase activity; calmodulin binding; hydrolase activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP3CA Products

Required fields are marked with *

My Review for All PPP3CA Products

Required fields are marked with *

0
cart-icon