Recombinant Human PPP3R1 protein, GST-tagged

Cat.No. : PPP3R1-1923H
Product Overview : Recombinant Human PPP3R1 protein(1-170 aa), fused with N-terminal GST tag, was expressed in E. coli.
Availability October 22, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : GST
Protein Length : 1-170 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Purity : 90%, by SDS-PAGE.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name PPP3R1 protein phosphatase 3, regulatory subunit B, alpha [ Homo sapiens ]
Official Symbol PPP3R1
Synonyms PPP3R1; protein phosphatase 3, regulatory subunit B, alpha; protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), alpha isoform (calcineurin B, type I) , protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, alpha isoform (calcineurin B, type I) , protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform; calcineurin subunit B type 1; calcineurin B; type I (19kDa); CALNB1; CNB; CNB1; protein phosphatase 2B regulatory subunit B alpha; calcineurin B, type I (19kDa); protein phosphatase 2B regulatory subunit 1; protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform; protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), alpha isoform (calcineurin B, type I); protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, alpha isoform (calcineurin B, type I);
mRNA Refseq NM_000945
Protein Refseq NP_000936
MIM 601302
UniProt ID P63098
Gene ID 5534

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP3R1 Products

Required fields are marked with *

My Review for All PPP3R1 Products

Required fields are marked with *

0
cart-icon
0
compare icon