Recombinant Human PPP3R1 protein, GST-tagged
Cat.No. : | PPP3R1-1923H |
Product Overview : | Recombinant Human PPP3R1 protein(1-170 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | October 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 1-170 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV |
Purity : | 90%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | PPP3R1 protein phosphatase 3, regulatory subunit B, alpha [ Homo sapiens ] |
Official Symbol | PPP3R1 |
Synonyms | PPP3R1; protein phosphatase 3, regulatory subunit B, alpha; protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), alpha isoform (calcineurin B, type I) , protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, alpha isoform (calcineurin B, type I) , protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform; calcineurin subunit B type 1; calcineurin B; type I (19kDa); CALNB1; CNB; CNB1; protein phosphatase 2B regulatory subunit B alpha; calcineurin B, type I (19kDa); protein phosphatase 2B regulatory subunit 1; protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform; protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), alpha isoform (calcineurin B, type I); protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, alpha isoform (calcineurin B, type I); |
mRNA Refseq | NM_000945 |
Protein Refseq | NP_000936 |
MIM | 601302 |
UniProt ID | P63098 |
Gene ID | 5534 |
◆ Recombinant Proteins | ||
PPP3R1-2158H | Recombinant Human PPP3R1 Protein (Met1-Val170), N-His tagged | +Inquiry |
PPP3R1-1119H | Recombinant Human PPP3R1 protein, His & GST-tagged | +Inquiry |
PPP3R1-7366H | Recombinant Human PPP3R1 protein(Gly2-Val170), His-tagged | +Inquiry |
PPP3R1-5946C | Recombinant Chicken PPP3R1 | +Inquiry |
PPP3R1-4300R | Recombinant Rat PPP3R1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP3R1-001HCL | Recombinant Human PPP3R1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP3R1 Products
Required fields are marked with *
My Review for All PPP3R1 Products
Required fields are marked with *