Recombinant Human PPP4R1 protein, His-tagged
Cat.No. : | PPP4R1-3116H |
Product Overview : | Recombinant Human PPP4R1 protein(331-520 aa), fused to His tag, was expressed in E. coli. |
Availability | August 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 331-520 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | NRTRDQEAPEDVQVRPEDTPSDLSVSNSSVILENTMEDHAAEASGKPLGEISVPLDSSLLCTLSSESHQEAASNENDKKPGNYKSMLRPEVGTTSQDSALLDQELYNSFHFWRTPLPEIDLDIELEQNSGGKPSPEGPEEESEGPVPSSPNITMATRKELEEMIENLEPHIDDPDVKAQVEVLSAALRAS |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PPP4R1 protein phosphatase 4, regulatory subunit 1 [ Homo sapiens ] |
Official Symbol | PPP4R1 |
Synonyms | PPP4R1; protein phosphatase 4, regulatory subunit 1; serine/threonine-protein phosphatase 4 regulatory subunit 1; PP4R1; serine/threonine phosphatase 4; PP4(Rmeg); |
Gene ID | 9989 |
mRNA Refseq | NM_001042388 |
Protein Refseq | NP_001035847 |
MIM | 604908 |
UniProt ID | Q8TF05 |
◆ Recombinant Proteins | ||
PPP4R1-10598Z | Recombinant Zebrafish PPP4R1 | +Inquiry |
Ppp4r1-1976R | Recombinant Rat Ppp4r1 Protein, His&GST-tagged | +Inquiry |
PPP4R1-4303R | Recombinant Rat PPP4R1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ppp4r1-5084M | Recombinant Mouse Ppp4r1 Protein, Myc/DDK-tagged | +Inquiry |
PPP4R1-4644R | Recombinant Rat PPP4R1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP4R1-2911HCL | Recombinant Human PPP4R1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP4R1 Products
Required fields are marked with *
My Review for All PPP4R1 Products
Required fields are marked with *