Recombinant Human PPP5C, His-tagged
Cat.No. : | PPP5C-27638TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-499 of Human PP5 with N terminal His tag, 58kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-499 a.a. |
Description : | This gene encodes a serine/threonine phosphatase which is a member of the protein phosphatase catalytic subunit family. Proteins in this family participate in pathways regulated by reversible phosphorylation at serine and threonine residues; many of these pathways are involved in the regulation of cell growth and differentiation. The product of this gene has been shown to participate in signaling pathways in response to hormones or cellular stress, and elevated levels of this protein may be associated with breast cancer development. Alternative splicing results in multiple transcript variants. |
Conjugation : | HIS |
Tissue specificity : | Ubiquitous. |
Form : | Lyophilised:Reconstitute with 140 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFK AKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECY GYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAAL RDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAG DEHKRSVVDSLDIESMTIEDEYSGPKLEDGKVTISFMK ELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLK ETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNG DFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDN MNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCING KVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDL LWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYI HLQGSDLRPQFHQFTAVPHPNVKPMAYANTLLQLGMM |
Sequence Similarities : | Belongs to the PPP phosphatase family. PP-5 (PP-T) subfamily.Contains 3 TPR repeats. |
Full Length : | Full L. |
Gene Name | PPP5C protein phosphatase 5, catalytic subunit [ Homo sapiens ] |
Official Symbol | PPP5C |
Synonyms | PPP5C; protein phosphatase 5, catalytic subunit; PPP5; serine/threonine-protein phosphatase 5; PP5; |
Gene ID | 5536 |
mRNA Refseq | NM_001204284 |
Protein Refseq | NP_001191213 |
MIM | 600658 |
Uniprot ID | P53041 |
Chromosome Location | 19q13.3 |
Pathway | ErbB1 downstream signaling, organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, conserved biosystem; |
Function | hydrolase activity; identical protein binding; metal ion binding; protein binding; protein serine/threonine phosphatase activity; |
◆ Recombinant Proteins | ||
PPP5C-3396R | Recombinant Rhesus Macaque PPP5C Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP5C-177H | Recombinant Human Protein Phosphatase 5, Catalytic Subunit | +Inquiry |
PPP5C-10H | Recombinant Human PPP5C Protein (14-778), N-GST-tagged | +Inquiry |
PPP5C-12H | Recombinant Human PPP5C protein, GST-tagged | +Inquiry |
PPP5C-176HB | Recombinant Human PPP5C Protein, His tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP5C-2908HCL | Recombinant Human PPP5C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP5C Products
Required fields are marked with *
My Review for All PPP5C Products
Required fields are marked with *