Recombinant Human PPP6C
Cat.No. : | PPP6C-29541TH |
Product Overview : | Recombinant full length Human PPP6C with N terminal proprietary tag; Predicted MW 59.29 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 305 amino acids |
Description : | This gene encodes the catalytic subunit of protein phosphatase, a component of a signaling pathway regulating cell cycle progression. Splice variants encoding different protein isoforms exist. The pseudogene of this gene is located on chromosome X. |
Molecular Weight : | 59.290kDa inclusive of tags |
Tissue specificity : | Ubiquitously expressed in all tissues tested with highest expression levels in testis, heart, kidney, brain, stomach, liver and skeletal muscle and lowest in placenta, lung colon and spleen. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESN VQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMG DFVDSGYYSLETFTYLLALKAKWPDRITLLRGNHESRQIT QVYGFYDECQTKYGNANAWRYCTKVLDMLTVAALIDEQIL CVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPE DVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLV HEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTR EPKLFRAVPDSERVIPPRTTTPYFL |
Sequence Similarities : | Belongs to the PPP phosphatase family. PP-6 (PP-V) subfamily. |
Gene Name | PPP6C protein phosphatase 6, catalytic subunit [ Homo sapiens ] |
Official Symbol | PPP6C |
Synonyms | PPP6C; protein phosphatase 6, catalytic subunit; serine/threonine-protein phosphatase 6 catalytic subunit; PP6; |
Gene ID | 5537 |
mRNA Refseq | NM_001123355 |
Protein Refseq | NP_001116827 |
MIM | 612725 |
Uniprot ID | O00743 |
Chromosome Location | 9q33.3 |
Function | hydrolase activity; metal ion binding; protein binding; protein serine/threonine phosphatase activity; |
◆ Recombinant Proteins | ||
PPP6C-4305R | Recombinant Rat PPP6C Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP6C-3597C | Recombinant Chicken PPP6C | +Inquiry |
PPP6C-13276M | Recombinant Mouse PPP6C Protein | +Inquiry |
PPP6C-1928H | Recombinant Human PPP6C, His-tagged | +Inquiry |
PPP6C-7046M | Recombinant Mouse PPP6C Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP6C-1407HCL | Recombinant Human PPP6C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP6C Products
Required fields are marked with *
My Review for All PPP6C Products
Required fields are marked with *
0
Inquiry Basket