Recombinant Human PQBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PQBP1-4239H
• Product Overview: PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_005701) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a nuclear polyglutamine-binding protein that is involved with transcription activation. The encoded protein contains a WW domain. Mutations in this gene have been found in patients with Renpenning syndrome 1 and other syndromes with X-linked cognitive disability. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.
• Molecular Mass: 30.5 kDa
• AA Sequence: MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PQBP1 polyglutamine binding protein 1 [ Homo sapiens (human) ]
• Official Symbol: PQBP1
• Synonyms: PQBP1; polyglutamine binding protein 1; mental retardation, X linked 55, MRX55, MRXS8, RENS1, SHS, Sutherland Haan X linked mental retardation syndrome; polyglutamine-binding protein 1; polyglutamine tract-binding protein 1; nuclear protein containing WW domain 38 kD; 38 kDa nuclear protein containing a WW domain; SHS; MRX55; MRXS3; MRXS8; NPW38; RENS1
• Gene ID: 10084
• mRNA Refseq: NM_005710
• Protein Refseq: NP_005701
• MIM: 300463
• UniProt ID: O60828