Recombinant Human PRAP1, His-tagged
| Cat.No. : | PRAP1-175H |
| Product Overview : | Recombinant Human Proline-Rich Acidic Protein 1/PRAP1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Val21-Gln151) of Human PRAP1 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 21-151 a.a. |
| AA Sequence : | VPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGRGPI LPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHP QVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
| Gene Name | PRAP1 proline-rich acidic protein 1 [ Homo sapiens ] |
| Official Symbol | PRAP1 |
| Synonyms | PRAP1; proline-rich acidic protein 1; UPA; PRO1195; RP11-122K13.6; MGC126792; |
| Gene ID | 118471 |
| mRNA Refseq | NM_001145201 |
| Protein Refseq | NP_001138673 |
| MIM | 609776 |
| UniProt ID | Q96NZ9 |
| Chromosome Location | 10q26.3 |
| ◆ Recombinant Proteins | ||
| PRAP1-370H | Recombinant Human PRAP1, His-tagged | +Inquiry |
| PRAP1-175H | Recombinant Human PRAP1, His-tagged | +Inquiry |
| PRAP1-4229H | Recombinant Human PRAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PRAP1-2919H | Recombinant Human PRAP1 Protein, MYC/DDK-tagged | +Inquiry |
| PRAP1-4653R | Recombinant Rat PRAP1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRAP1-002HCL | Recombinant Human PRAP1 cell lysate | +Inquiry |
| PRAP1-001HCL | Recombinant Human PRAP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRAP1 Products
Required fields are marked with *
My Review for All PRAP1 Products
Required fields are marked with *



