Recombinant Human PRCD Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PRCD-2952H
Product Overview : PRCD MS Standard C13 and N15-labeled recombinant protein (NP_001071088) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is predominantly expressed in the retina, and mutations in this gene are the cause of autosomal recessive retinal degeneration in both humans and dogs. Alternatively spliced transcript variants have been found for this gene.
Molecular Mass : 5.8 kDa
AA Sequence : MCTTLFLLSTLAMLWRRRFANRVQPEPSDVDGAARGSSLDADPQSSGREKEPLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PRCD photoreceptor disc component [ Homo sapiens (human) ]
Official Symbol PRCD
Synonyms PRCD; photoreceptor disc component; RP36; photoreceptor disk component PRCD; progressive rod-cone degeneration protein
Gene ID 768206
mRNA Refseq NM_001077620
Protein Refseq NP_001071088
MIM 610598
UniProt ID Q00LT1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRCD Products

Required fields are marked with *

My Review for All PRCD Products

Required fields are marked with *

0
cart-icon