Recombinant Human PRCD Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PRCD-2952H |
| Product Overview : | PRCD MS Standard C13 and N15-labeled recombinant protein (NP_001071088) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene is predominantly expressed in the retina, and mutations in this gene are the cause of autosomal recessive retinal degeneration in both humans and dogs. Alternatively spliced transcript variants have been found for this gene. |
| Molecular Mass : | 5.8 kDa |
| AA Sequence : | MCTTLFLLSTLAMLWRRRFANRVQPEPSDVDGAARGSSLDADPQSSGREKEPLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PRCD photoreceptor disc component [ Homo sapiens (human) ] |
| Official Symbol | PRCD |
| Synonyms | PRCD; photoreceptor disc component; RP36; photoreceptor disk component PRCD; progressive rod-cone degeneration protein |
| Gene ID | 768206 |
| mRNA Refseq | NM_001077620 |
| Protein Refseq | NP_001071088 |
| MIM | 610598 |
| UniProt ID | Q00LT1 |
| ◆ Recombinant Proteins | ||
| Prcd-008M | Recombinant Mouse Prcd Protein, MYC/DDK-tagged | +Inquiry |
| PRCD-2916H | Recombinant Human PRCD Protein, MYC/DDK-tagged | +Inquiry |
| PRCD-1003H | Recombinant Human PRCD | +Inquiry |
| PRCD-2952H | Recombinant Human PRCD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PRCD-3902H | Recombinant Human PRCD Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRCD Products
Required fields are marked with *
My Review for All PRCD Products
Required fields are marked with *
