Recombinant Human PRDM12 protein, GST-tagged
| Cat.No. : | PRDM12-7853H |
| Product Overview : | Recombinant Human PRDM12 protein(218-325 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 218-325 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | LEEDQKKNKHEDFHPADSAAGPAGRMRCVICHRGFNSRSNLRSHMRIHTLDKPFVCRFCNRRFSQSSTLRNHVRLHTGERPYKCQVCQSAYSQLAGLRAHQKSARHRP |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | PRDM12 |
| Synonyms | PRDM12; PR domain containing 12; PR domain zinc finger protein 12; PR domain containing protein 12; PR domain-containing protein 12; PR-domain containing protein 12; PR-domain zinc finger protein 12; PFM9; |
| Gene ID | 59335 |
| mRNA Refseq | NM_021619 |
| Protein Refseq | NP_067632 |
| UniProt ID | Q9H4Q4 |
| ◆ Recombinant Proteins | ||
| PRDM12-1756H | Recombinant Human PRDM12 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRDM12-7854H | Recombinant Human PRDM12 protein, His-tagged | +Inquiry |
| Prdm12-5099M | Recombinant Mouse Prdm12 Protein, Myc/DDK-tagged | +Inquiry |
| PRDM12-7853H | Recombinant Human PRDM12 protein, GST-tagged | +Inquiry |
| PRDM12-802HFL | Recombinant Full Length Human PRDM12 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRDM12 Products
Required fields are marked with *
My Review for All PRDM12 Products
Required fields are marked with *
