Recombinant Human PRDM16 protein, GST-tagged
Cat.No. : | PRDM16-301430H |
Product Overview : | Recombinant Human PRDM16 (1080-1230 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ile1080-Lys1230 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | IANSEMNQASTRTEKRADMQIVDGSAQCPGLASEKQEDVEEEDDDDLEEDDEDSLAGKSQDDTVSPAPEPQAAYEDEEDEEPAASLAVGFDHTRRCAEDHEGGLLALEPMPTFGKGLDLRRAAEEAFEVKDVLNSTLDSEALKHTLCRQAK |
Gene Name | PRDM16 PR domain containing 16 [ Homo sapiens ] |
Official Symbol | PRDM16 |
Synonyms | PRDM16; PR domain containing 16; PR domain zinc finger protein 16; KIAA1675; MDS1/EVI1 like; MEL1; MGC166915; PFM13; transcription factor MEL1; MDS1/EVI1-like gene 1; |
Gene ID | 63976 |
mRNA Refseq | NM_022114 |
Protein Refseq | NP_071397 |
MIM | 605557 |
UniProt ID | Q9HAZ2 |
◆ Recombinant Proteins | ||
PRDM16-3097HFL | Recombinant Full Length Human PRDM16 protein, Flag-tagged | +Inquiry |
PRDM16-3247H | Recombinant Human PRDM16 protein, His-tagged | +Inquiry |
PRDM16-301430H | Recombinant Human PRDM16 protein, GST-tagged | +Inquiry |
PRDM16-3333H | Recombinant Human PRDM16 protein, His-tagged | +Inquiry |
Prdm16-5100M | Recombinant Mouse Prdm16 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRDM16 Products
Required fields are marked with *
My Review for All PRDM16 Products
Required fields are marked with *