Recombinant Human PRDX1 Protein (1-199 aa), His-tagged
Cat.No. : | PRDX1-2430H |
Product Overview : | Recombinant Human PRDX1 Protein (1-199 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-199 aa |
Description : | Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2. Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 24.6 kDa |
AA Sequence : | MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | PRDX1 peroxiredoxin 1 [ Homo sapiens ] |
Official Symbol | PRDX1 |
Synonyms | PRDX1; peroxiredoxin 1; PAGA; peroxiredoxin-1; NKEFA; NKEF-A; PAG; PAGB; PRX1; PRXI; MSP23; TDPX2; |
Gene ID | 5052 |
mRNA Refseq | NM_001202431 |
Protein Refseq | NP_001189360 |
MIM | 176763 |
UniProt ID | Q06830 |
◆ Recombinant Proteins | ||
PRDX1-423H | Recombinant Full Length Human Peroxiredoxin 1, His-tagged | +Inquiry |
PRDX1-2430H | Recombinant Human PRDX1 Protein (1-199 aa), His-tagged | +Inquiry |
PRDX1-2153Z | Recombinant Zebrafish PRDX1 | +Inquiry |
Prdx1-8047M | Recombinant Mouse Prdx1 protein, His & GST-tagged | +Inquiry |
PRDX1-134H | Recombinant Full Length Human PRDX1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRDX1-2882HCL | Recombinant Human PRDX1 293 Cell Lysate | +Inquiry |
PRDX1-2883HCL | Recombinant Human PRDX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRDX1 Products
Required fields are marked with *
My Review for All PRDX1 Products
Required fields are marked with *
0
Inquiry Basket