Recombinant Human PRDX1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PRDX1-3543H |
Product Overview : | PRDX1 MS Standard C13 and N15-labeled recombinant protein (NP_859048) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. Four transcript variants encoding the same protein have been identified for this gene. |
Molecular Mass : | 22.1 kDa |
AA Sequence : | MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PRDX1 peroxiredoxin 1 [ Homo sapiens (human) ] |
Official Symbol | PRDX1 |
Synonyms | PRDX1; peroxiredoxin 1; PAGA; peroxiredoxin-1; NKEFA; NKEF-A; thioredoxin peroxidase 2; proliferation-associated gene A; natural killer-enhancing factor A; proliferation-associated gene protein; natural killer cell-enhancing factor A; thioredoxin-dependent peroxide reductase 2; PAG; PAGB; PRX1; PRXI; MSP23; TDPX2; |
Gene ID | 5052 |
mRNA Refseq | NM_181697 |
Protein Refseq | NP_859048 |
MIM | 176763 |
UniProt ID | Q06830 |
◆ Recombinant Proteins | ||
PRDX1-2033C | Recombinant Cricetulus Griseus PRDX1 Protein (2-199 aa), His-tagged | +Inquiry |
PRDX1-3543H | Recombinant Human PRDX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Prdx1-2544M | Recombinant Mouse Prdx1 protein(Met1-Lys199), His-tagged | +Inquiry |
PRDX1-4317R | Recombinant Rat PRDX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Prdx1-8047M | Recombinant Mouse Prdx1 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRDX1-2882HCL | Recombinant Human PRDX1 293 Cell Lysate | +Inquiry |
PRDX1-2883HCL | Recombinant Human PRDX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRDX1 Products
Required fields are marked with *
My Review for All PRDX1 Products
Required fields are marked with *