Recombinant Human PRDX2 protein, GST-tagged
Cat.No. : | PRDX2-336H |
Product Overview : | Recombinant Human PRDX2 protein(NP_005800)(1-198 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-198 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). |
Gene Name | PRDX2 peroxiredoxin 2 [ Homo sapiens ] |
Official Symbol | PRDX2 |
Synonyms | PRDX2; peroxiredoxin 2; TDPX1; peroxiredoxin-2; MGC4104; natural killer enhancing factor B; NKEFB; PRP; PRX2; PRXII; thiol specific antioxidant 1; thioredoxin peroxidase 1; thioredoxin dependent peroxide reductase 1; torin; TSA; NKEF-B; thiol-specific antioxidant 1; thiol-specific antioxidant protein; natural killer cell-enhancing factor B; thioredoxin-dependent peroxide reductase 1; TPX1; |
Gene ID | 7001 |
mRNA Refseq | NM_005809 |
Protein Refseq | NP_005800 |
MIM | 600538 |
UniProt ID | P32119 |
◆ Recombinant Proteins | ||
Prdx2-335R | Recombinant Rat Prdx2 Protein, His-tagged | +Inquiry |
PRDX2-697H | Recombinant Human PRDX2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRDX2-333H | Recombinant Human PRDX2 Protein, His/GST-tagged | +Inquiry |
PRDX2-1438H | Active Recombinant Human Peroxiredoxin 2, His-tagged | +Inquiry |
PRDX2-1239HFL | Recombinant Full Length Human PRDX2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRDX2-564HCL | Recombinant Human PRDX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRDX2 Products
Required fields are marked with *
My Review for All PRDX2 Products
Required fields are marked with *
0
Inquiry Basket