Recombinant Human PRDX5 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PRDX5-2683H |
Product Overview : | PRDX5 MS Standard C13 and N15-labeled recombinant protein (NP_857634) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein interacts with peroxisome receptor 1 and plays an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. The use of alternate transcription start sites is thought to result in transcript variants that use different in-frame translational start codons to generate isoforms that are targeted to the mitochondrion (isoform L) or peroxisome/cytoplasm (isoform S). Multiple related pseudogenes have been defined for this gene. |
Molecular Mass : | 17.4 kDa |
AA Sequence : | MGLAGVCALRRSAGYILVGGAGGQSAAAAARRCSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PRDX5 peroxiredoxin 5 [ Homo sapiens (human) ] |
Official Symbol | PRDX5 |
Synonyms | PRDX5; peroxiredoxin 5; peroxiredoxin-5, mitochondrial; ACR1; Alu co repressor 1; antioxidant enzyme B166; AOEB166; B166; liver tissue 2D page spot 71B; MGC117264; MGC142283; MGC142285; peroxisomal antioxidant enzyme; PLP; PMP20; PRDX6; PRXV; SBBI10; thioredoxin peroxidase PMP20; TPx type VI; prx-V; peroxiredoxin V; alu corepressor 1; Alu co-repressor 1; thioredoxin reductase; liver tissue 2D-page spot 71B; |
Gene ID | 25824 |
mRNA Refseq | NM_181651 |
Protein Refseq | NP_857634 |
MIM | 606583 |
UniProt ID | P30044 |
◆ Recombinant Proteins | ||
PRDX5-4320R | Recombinant Rat PRDX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Prdx5-5104M | Recombinant Mouse Prdx5 Protein, Myc/DDK-tagged | +Inquiry |
PRDX5-4172H | Recombinant Human PRDX5 Protein (Met53-Leu214), N-His tagged | +Inquiry |
PRDX5-7073M | Recombinant Mouse PRDX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Prdx5-327R | Recombinant Rat Prdx5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRDX5-2879HCL | Recombinant Human PRDX5 293 Cell Lysate | +Inquiry |
PRDX5-2878HCL | Recombinant Human PRDX5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRDX5 Products
Required fields are marked with *
My Review for All PRDX5 Products
Required fields are marked with *
0
Inquiry Basket