Recombinant Human PRDX5 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PRDX5-3781H
Product Overview : PRDX5 MS Standard C13 and N15-labeled recombinant protein (NP_036226) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein interacts with peroxisome receptor 1 and plays an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. The use of alternate transcription start sites is thought to result in transcript variants that use different in-frame translational start codons to generate isoforms that are targeted to the mitochondrion (isoform L) or peroxisome/cytoplasm (isoform S). Multiple related pseudogenes have been defined for this gene.
Molecular Mass : 22 kDa
AA Sequence : MGLAGVCALRRSAGYILVGGAGGQSAAAAARRCSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PRDX5 peroxiredoxin 5 [ Homo sapiens (human) ]
Official Symbol PRDX5
Synonyms PRDX5; peroxiredoxin 5; peroxiredoxin-5, mitochondrial; ACR1; Alu co repressor 1; antioxidant enzyme B166; AOEB166; B166; liver tissue 2D page spot 71B; MGC117264; MGC142283; MGC142285; peroxisomal antioxidant enzyme; PLP; PMP20; PRDX6; PRXV; SBBI10; thioredoxin peroxidase PMP20; TPx type VI; prx-V; peroxiredoxin V; alu corepressor 1; Alu co-repressor 1; thioredoxin reductase; liver tissue 2D-page spot 71B;
Gene ID 25824
mRNA Refseq NM_012094
Protein Refseq NP_036226
MIM 606583
UniProt ID P30044

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRDX5 Products

Required fields are marked with *

My Review for All PRDX5 Products

Required fields are marked with *

0
cart-icon
0
compare icon