Recombinant Human PREPL Protein, GST-tagged
| Cat.No. : | PREPL-22H |
| Product Overview : | Human PREPL full-length ORF ( NP_006027.2, 1 a.a. - 727 a.a.) recombinant protein with GST-tag at N-terminal was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene belongs to the prolyl oligopeptidase subfamily of serine peptidases. Mutations in this gene have been associated with hypotonia-cystinuria syndrome, also known as the 2p21 deletion syndrome. Several alternatively spliced transcript variants encoding either the same or different isoforms have been described for this gene. |
| Molecular Mass : | 110.3 kDa |
| AA Sequence : | MQQKTKLFLQALKYSIPHLGKCMQKQHLNHYNFADHCYNRIKLKKYHLTKCLQNKPKISELARNIPSRSFSCKDLQPVKQENEKPLPENMDAFEKVRTKLETQPQEEYEIINVEVKHGGFVYYQEGCCLVRSKDEEADNDNYEVLFNLEELKLDQPFIDCIRVAPDEKYVAAKIRTEDSEASTCVIIKLSDQPVMEASFPNVSSFEWVKDEEDEDVLFYTFQRNLRCHDVYRATFGDNKRNERFYTEKDPSYFVFLYLTKDSRFLTINIMNKTTSEVWLIDGLSPWDPPVLIQKRIHGVLYYVEHRDDELYILTNVGEPTEFKLMRTAADTPAIMNWDLFFTMKRNTKVIDLDMFKDHCVLFLKHSNLLYVNVIGLADDSVRSLKLPPWACGFIMDTNSDPKNCPFQLCSPIRPPKYYTYKFAEGKLFEETGHEDPITKTSRVLRLEAKSKDGKLVPMTVFHKTDSEDLQKKPLLVHVYGAYGMDLKMNFRPERRVLVDDGWILAYCHVRGGGELGLQWHADGRLTKKLNGLADLEACIKTLHGQGFSQPSLTTLTAFSAGGVLAGALCNSNPELVRAVTLEAPFLDVLNTMMDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCPYQNIKPQHYPSIHITAYENDERVPLKGIVSYTEKLKEAIAEHAKDTGEGYQTPNIILDIQPGGNHVIEDSHKKITAQIKFLYEELGLDSTSVFEDLKKYLKF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | PREPL prolyl endopeptidase like [ Homo sapiens (human) ] |
| Official Symbol | PREPL |
| Synonyms | PREPL; prolyl endopeptidase like; CMS22; prolyl endopeptidase-like; putative prolyl oligopeptidase; EC 3.4.21.- |
| Gene ID | 9581 |
| mRNA Refseq | NM_006036 |
| Protein Refseq | NP_006027 |
| MIM | 609557 |
| UniProt ID | Q4J6C6 |
| ◆ Recombinant Proteins | ||
| PREPL-4325R | Recombinant Rat PREPL Protein, His (Fc)-Avi-tagged | +Inquiry |
| PREPL-7077M | Recombinant Mouse PREPL Protein, His (Fc)-Avi-tagged | +Inquiry |
| PREPL-3598R | Recombinant Rhesus monkey PREPL Protein, His-tagged | +Inquiry |
| PREPL-2733C | Recombinant Chicken PREPL | +Inquiry |
| PREPL-22H | Recombinant Human PREPL Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PREPL-1411HCL | Recombinant Human PREPL cell lysate | +Inquiry |
| PREPL-402HKCL | Human PREPL Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PREPL Products
Required fields are marked with *
My Review for All PREPL Products
Required fields are marked with *
