Recombinant Human PREPL Protein, GST-tagged
Cat.No. : | PREPL-22H |
Product Overview : | Human PREPL full-length ORF ( NP_006027.2, 1 a.a. - 727 a.a.) recombinant protein with GST-tag at N-terminal was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the prolyl oligopeptidase subfamily of serine peptidases. Mutations in this gene have been associated with hypotonia-cystinuria syndrome, also known as the 2p21 deletion syndrome. Several alternatively spliced transcript variants encoding either the same or different isoforms have been described for this gene. |
Molecular Mass : | 110.3 kDa |
AA Sequence : | MQQKTKLFLQALKYSIPHLGKCMQKQHLNHYNFADHCYNRIKLKKYHLTKCLQNKPKISELARNIPSRSFSCKDLQPVKQENEKPLPENMDAFEKVRTKLETQPQEEYEIINVEVKHGGFVYYQEGCCLVRSKDEEADNDNYEVLFNLEELKLDQPFIDCIRVAPDEKYVAAKIRTEDSEASTCVIIKLSDQPVMEASFPNVSSFEWVKDEEDEDVLFYTFQRNLRCHDVYRATFGDNKRNERFYTEKDPSYFVFLYLTKDSRFLTINIMNKTTSEVWLIDGLSPWDPPVLIQKRIHGVLYYVEHRDDELYILTNVGEPTEFKLMRTAADTPAIMNWDLFFTMKRNTKVIDLDMFKDHCVLFLKHSNLLYVNVIGLADDSVRSLKLPPWACGFIMDTNSDPKNCPFQLCSPIRPPKYYTYKFAEGKLFEETGHEDPITKTSRVLRLEAKSKDGKLVPMTVFHKTDSEDLQKKPLLVHVYGAYGMDLKMNFRPERRVLVDDGWILAYCHVRGGGELGLQWHADGRLTKKLNGLADLEACIKTLHGQGFSQPSLTTLTAFSAGGVLAGALCNSNPELVRAVTLEAPFLDVLNTMMDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCPYQNIKPQHYPSIHITAYENDERVPLKGIVSYTEKLKEAIAEHAKDTGEGYQTPNIILDIQPGGNHVIEDSHKKITAQIKFLYEELGLDSTSVFEDLKKYLKF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PREPL prolyl endopeptidase like [ Homo sapiens (human) ] |
Official Symbol | PREPL |
Synonyms | PREPL; prolyl endopeptidase like; CMS22; prolyl endopeptidase-like; putative prolyl oligopeptidase; EC 3.4.21.- |
Gene ID | 9581 |
mRNA Refseq | NM_006036 |
Protein Refseq | NP_006027 |
MIM | 609557 |
UniProt ID | Q4J6C6 |
◆ Recombinant Proteins | ||
PREPL-4325R | Recombinant Rat PREPL Protein, His (Fc)-Avi-tagged | +Inquiry |
PREPL-2733C | Recombinant Chicken PREPL | +Inquiry |
PREPL-4666R | Recombinant Rat PREPL Protein | +Inquiry |
PREPL-22H | Recombinant Human PREPL Protein, GST-tagged | +Inquiry |
PREPL-7077M | Recombinant Mouse PREPL Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PREPL-1411HCL | Recombinant Human PREPL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PREPL Products
Required fields are marked with *
My Review for All PREPL Products
Required fields are marked with *
0
Inquiry Basket