Recombinant Human PRG3, His-tagged
Cat.No. : | PRG3-812H |
Product Overview : | Recombinant Human Proteoglycan 3/PRG3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Leu18-Phe225) of Human PRG3 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | Proteoglycan 3, also known as Eosinophil major basic protein homolog, Prepro-major basic protein homolog, PRG3 and MBPH, contains one C-type lectin domain. Proteoglycans are a major component of the animal extracellular matrix. PRG3 localizes to the eosinophil secondary granule and is expressed in bone marrow, not detected in placenta. PRG3 has similar cytotoxic and cytostimulatory activities to PRG2/MBP. In vitro, PRG3 can stimulate neutrophil superoxide production and IL8 release, histamine and leukotriene C4 release from basophils. |
Form : | Lyophilized from a 0.2 μm filtered solution of 20mM PBS, 150mM NaCl, pH 7.2 |
AA Sequence : | LHLENDAPHLESLETQADLGQDLDSSKEQERDLALTEEVIQAEGEEVKASACQDNFEDEEAMESD PAALDKDFQCPREEDIVEVQGSPRCKTCRYLLVRTPKTFAEAQNVCSRCYGGNLVSIHDFNFNYR IQCCTSTVNQAQVWIGGNLRGWFLWKRFCWTDGSHWNFAYWSPGQPGNGQGSCVALCTKGGYWRR AQCDKQLPFVCSFVDHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20ºC, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7ºCfor 2-7 days. Aliquots of reconstituted samples are stable at < -20ºC for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | PRG3 proteoglycan 3 [ Homo sapiens (human) ] |
Official Symbol | PRG3 |
Synonyms | PRG3; proteoglycan 3; MBP2; MBPH; eosinophil major basic protein homolog; prepro-MBPH; prepro-major basic protein homolog |
Gene ID | 10394 |
mRNA Refseq | NM_006093 |
Protein Refseq | NP_006084 |
MIM | 606814 |
UniProt ID | Q9Y2Y8 |
Chromosome Location | 11q12 |
Function | carbohydrate binding |
◆ Recombinant Proteins | ||
PRG3-13338M | Recombinant Mouse PRG3 Protein | +Inquiry |
PRG3-4315HFL | Recombinant Full Length Human PRG3, Flag-tagged | +Inquiry |
PRG3-812H | Recombinant Human PRG3, His-tagged | +Inquiry |
PRG3-811H | Recombinant Human PRG3, MYC/DDK-tagged | +Inquiry |
Prg3-5108M | Recombinant Mouse Prg3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRG3-498HCL | Recombinant Human PRG3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRG3 Products
Required fields are marked with *
My Review for All PRG3 Products
Required fields are marked with *
0
Inquiry Basket