Recombinant Human PRG3, His-tagged

Cat.No. : PRG3-812H
Product Overview : Recombinant Human Proteoglycan 3/PRG3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Leu18-Phe225) of Human PRG3 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : Proteoglycan 3, also known as Eosinophil major basic protein homolog, Prepro-major basic protein homolog, PRG3 and MBPH, contains one C-type lectin domain. Proteoglycans are a major component of the animal extracellular matrix. PRG3 localizes to the eosinophil secondary granule and is expressed in bone marrow, not detected in placenta. PRG3 has similar cytotoxic and cytostimulatory activities to PRG2/MBP. In vitro, PRG3 can stimulate neutrophil superoxide production and IL8 release, histamine and leukotriene C4 release from basophils.
Form : Lyophilized from a 0.2 μm filtered solution of 20mM PBS, 150mM NaCl, pH 7.2
AA Sequence : LHLENDAPHLESLETQADLGQDLDSSKEQERDLALTEEVIQAEGEEVKASACQDNFEDEEAMESD PAALDKDFQCPREEDIVEVQGSPRCKTCRYLLVRTPKTFAEAQNVCSRCYGGNLVSIHDFNFNYR IQCCTSTVNQAQVWIGGNLRGWFLWKRFCWTDGSHWNFAYWSPGQPGNGQGSCVALCTKGGYWRR AQCDKQLPFVCSFVDHHHHHH
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20ºC, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7ºCfor 2-7 days. Aliquots of reconstituted samples are stable at < -20ºC for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name PRG3 proteoglycan 3 [ Homo sapiens (human) ]
Official Symbol PRG3
Synonyms PRG3; proteoglycan 3; MBP2; MBPH; eosinophil major basic protein homolog; prepro-MBPH; prepro-major basic protein homolog
Gene ID 10394
mRNA Refseq NM_006093
Protein Refseq NP_006084
MIM 606814
UniProt ID Q9Y2Y8
Chromosome Location 11q12
Function carbohydrate binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRG3 Products

Required fields are marked with *

My Review for All PRG3 Products

Required fields are marked with *

0
cart-icon