Recombinant Human PRIM1 Protein (1-420 aa), His-SUMO-tagged
Cat.No. : | PRIM1-2085H |
Product Overview : | Recombinant Human PRIM1 Protein (1-420 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-420 aa |
Description : | DNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 65.9 kDa |
AA Sequence : | METFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSRKGELLKKSDLQKDF |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | PRIM1 primase, DNA, polypeptide 1 (49kDa) [ Homo sapiens ] |
Official Symbol | PRIM1 |
Synonyms | PRIM1; DNA primase 1; p49; MGC12308; |
Gene ID | 5557 |
mRNA Refseq | NM_000946 |
Protein Refseq | NP_000937 |
MIM | 176635 |
UniProt ID | P49642 |
◆ Recombinant Proteins | ||
PRIM1-0206H | Recombinant Human PRIM1 Protein (M1-F420), Tag Free | +Inquiry |
PRIM1-7082M | Recombinant Mouse PRIM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRIM1-11495Z | Recombinant Zebrafish PRIM1 | +Inquiry |
PRIM1-2085H | Recombinant Human PRIM1 Protein (1-420 aa), His-SUMO-tagged | +Inquiry |
PRIM1-13345M | Recombinant Mouse PRIM1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRIM1-2870HCL | Recombinant Human PRIM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRIM1 Products
Required fields are marked with *
My Review for All PRIM1 Products
Required fields are marked with *
0
Inquiry Basket