Recombinant Human PRKAB1 protein, His-tagged
| Cat.No. : | PRKAB1-3081H |
| Product Overview : | Recombinant Human PRKAB1 protein(1 - 70 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 14, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1 - 70 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVN |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit [ Homo sapiens ] |
| Official Symbol | PRKAB1 |
| Synonyms | PRKAB1; protein kinase, AMP-activated, beta 1 non-catalytic subunit; 5-AMP-activated protein kinase subunit beta-1; AMPK beta 1; AMPKb; AMPK beta -1 chain; AMPK subunit beta-1; AMP-activated protein kinase beta subunit; 5-AMP-activated protein kinase beta-1 subunit; protein kinase, AMP-activated, noncatalytic, beta-1; AMPK; HAMPKb; MGC17785; |
| Gene ID | 5564 |
| mRNA Refseq | NM_006253 |
| Protein Refseq | NP_006244 |
| MIM | 602740 |
| UniProt ID | Q9Y478 |
| ◆ Recombinant Proteins | ||
| Prkab1-4932M | Recombinant Mouse Prkab1 protein, His-tagged | +Inquiry |
| PRKAB1-4868H | Recombinant Human Protein Kinase, AMP-Activated, Beta 1 Non-Catalytic Subunit, His-tagged | +Inquiry |
| PRKAB1-0736H | Recombinant Human PRKAB1 Protein (G2-I270), GST tagged | +Inquiry |
| PRKAB1-4867H | Recombinant Human Protein Kinase, AMP-Activated, Beta 1 Non-Catalytic Subunit, His-tagged | +Inquiry |
| PRKAB1-3249H | Recombinant Human PRKAB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AMPK-412HCL | Recombinant Human AMPK cell lysate | +Inquiry |
| AMPK-411HCL | Recombinant Human AMPK cell lysate | +Inquiry |
| AMPK-410HCL | Recombinant Human AMPK cell lysate | +Inquiry |
| PRKAB1-2869HCL | Recombinant Human PRKAB1 293 Cell Lysate | +Inquiry |
| AMPK-416HCL | Recombinant Human AMPK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRKAB1 Products
Required fields are marked with *
My Review for All PRKAB1 Products
Required fields are marked with *
