Recombinant Human PRKAB1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PRKAB1-3249H
Product Overview : PRKAB1 MS Standard C13 and N15-labeled recombinant protein (NP_006244) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex.
Molecular Mass : 30.4 kDa
AA Sequence : MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PRKAB1 protein kinase AMP-activated non-catalytic subunit beta 1 [ Homo sapiens (human) ]
Official Symbol PRKAB1
Synonyms PRKAB1; protein kinase, AMP-activated, beta 1 non-catalytic subunit; 5-AMP-activated protein kinase subunit beta-1; AMPK beta 1; AMPKb; AMPK beta -1 chain; AMPK subunit beta-1; AMP-activated protein kinase beta subunit; 5-AMP-activated protein kinase beta-1 subunit; protein kinase, AMP-activated, noncatalytic, beta-1; AMPK; HAMPKb; MGC17785;
Gene ID 5564
mRNA Refseq NM_006253
Protein Refseq NP_006244
MIM 602740
UniProt ID Q9Y478

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRKAB1 Products

Required fields are marked with *

My Review for All PRKAB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon