Recombinant Human PRKAG1 protein, His-tagged
| Cat.No. : | PRKAG1-2793H |
| Product Overview : | Recombinant Human PRKAG1 protein(164-321 aa), fused to His tag, was expressed in E. coli. |
| Availability | September 27, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 164-321 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQA |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit [ Homo sapiens ] |
| Official Symbol | PRKAG1 |
| Synonyms | PRKAG1; protein kinase, AMP-activated, gamma 1 non-catalytic subunit; 5-AMP-activated protein kinase subunit gamma-1; AMPK gamma1; AMPK gamma-1 chain; 5-AMP-activated protein kinase, gamma-1 subunit; AMPKG; MGC8666; |
| Gene ID | 5571 |
| mRNA Refseq | NM_001206709 |
| Protein Refseq | NP_001193638 |
| MIM | 602742 |
| UniProt ID | P54619 |
| ◆ Recombinant Proteins | ||
| PRKAG1-3421R | Recombinant Rhesus Macaque PRKAG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRKAG1-4332R | Recombinant Rat PRKAG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRKAG1-7088M | Recombinant Mouse PRKAG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRKAG1-365H | Recombinant Human PRKAG1 protein, His/MBP-tagged | +Inquiry |
| PRKAG1-4673R | Recombinant Rat PRKAG1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRKAG1-2866HCL | Recombinant Human PRKAG1 293 Cell Lysate | +Inquiry |
| PRKAG1-2865HCL | Recombinant Human PRKAG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRKAG1 Products
Required fields are marked with *
My Review for All PRKAG1 Products
Required fields are marked with *
