Recombinant Human PRKAG1 protein, His-tagged
Cat.No. : | PRKAG1-2793H |
Product Overview : | Recombinant Human PRKAG1 protein(164-321 aa), fused to His tag, was expressed in E. coli. |
Availability | August 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 164-321 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQA |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit [ Homo sapiens ] |
Official Symbol | PRKAG1 |
Synonyms | PRKAG1; protein kinase, AMP-activated, gamma 1 non-catalytic subunit; 5-AMP-activated protein kinase subunit gamma-1; AMPK gamma1; AMPK gamma-1 chain; 5-AMP-activated protein kinase, gamma-1 subunit; AMPKG; MGC8666; |
Gene ID | 5571 |
mRNA Refseq | NM_001206709 |
Protein Refseq | NP_001193638 |
MIM | 602742 |
UniProt ID | P54619 |
◆ Recombinant Proteins | ||
Prkag1-5113M | Recombinant Mouse Prkag1 Protein, Myc/DDK-tagged | +Inquiry |
PRKAG1-12377Z | Recombinant Zebrafish PRKAG1 | +Inquiry |
PRKAG1-2334H | Recombinant Human PRKAG1, His-tagged | +Inquiry |
PRKAG1-3603R | Recombinant Rhesus monkey PRKAG1 Protein, His-tagged | +Inquiry |
PRKAG1-2793H | Recombinant Human PRKAG1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRKAG1-2865HCL | Recombinant Human PRKAG1 293 Cell Lysate | +Inquiry |
PRKAG1-2866HCL | Recombinant Human PRKAG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRKAG1 Products
Required fields are marked with *
My Review for All PRKAG1 Products
Required fields are marked with *