Recombinant Human PRKCH protein, GST-tagged

Cat.No. : PRKCH-301284H
Product Overview : Recombinant Human PRKCH (634-683 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Arg634-Pro683
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : RIKSREDVSNFDPDFIKEEPVLTPIDEGHLPMINQDEFRNFSYVSPELQP
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name PRKCH protein kinase C, eta [ Homo sapiens ]
Official Symbol PRKCH
Synonyms PRKCH; protein kinase C, eta; PRKCL; protein kinase C eta type; PKC L; PKCL; PKC-L; nPKC-eta; MGC5363; MGC26269;
Gene ID 5583
mRNA Refseq NM_006255
Protein Refseq NP_006246
MIM 605437
UniProt ID P24723

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRKCH Products

Required fields are marked with *

My Review for All PRKCH Products

Required fields are marked with *

0
cart-icon