Recombinant Human PRKCQ protein, His-tagged
Cat.No. : | PRKCQ-3942H |
Product Overview : | Recombinant Human PRKCQ protein(1-145 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | June 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 1-145 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTFDAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGKTEIWLELKPQGRMLMNARYFLEMSDTKDMNEFETEGFFALHQR |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | PRKCQ protein kinase C, theta [ Homo sapiens ] |
Official Symbol | PRKCQ |
Synonyms | PRKCQ; protein kinase C, theta; protein kinase C theta type; PRKCT; nPKC-theta; MGC126514; MGC141919; |
mRNA Refseq | NM_001242413 |
Protein Refseq | NP_001229342 |
MIM | 600448 |
UniProt ID | Q04759 |
Gene ID | 5588 |
◆ Recombinant Proteins | ||
PRKCQ-5515HF | Active Recombinant Full Length Human PRKCQ Protein, GST-tagged | +Inquiry |
PRKCQ-301488H | Recombinant Human PRKCQ protein, GST-tagged | +Inquiry |
PRKCQ-30178TH | Recombinant Full Length Human PRKCQ Protein, GST tagged | +Inquiry |
PRKCQ-152HFL | Active Recombinant Full Length Human PRKCQ Protein, C-His-tagged | +Inquiry |
PRKCQ-3942H | Recombinant Human PRKCQ protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRKCQ-1416HCL | Recombinant Human PRKCQ cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRKCQ Products
Required fields are marked with *
My Review for All PRKCQ Products
Required fields are marked with *