Recombinant Human PRKCQ protein, His-tagged

Cat.No. : PRKCQ-3942H
Product Overview : Recombinant Human PRKCQ protein(1-145 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability December 11, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : His
Protein Length : 1-145 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTFDAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGKTEIWLELKPQGRMLMNARYFLEMSDTKDMNEFETEGFFALHQR
Purity : 85%, by SDS-PAGE.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name PRKCQ protein kinase C, theta [ Homo sapiens ]
Official Symbol PRKCQ
Synonyms PRKCQ; protein kinase C, theta; protein kinase C theta type; PRKCT; nPKC-theta; MGC126514; MGC141919;
mRNA Refseq NM_001242413
Protein Refseq NP_001229342
MIM 600448
UniProt ID Q04759
Gene ID 5588

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRKCQ Products

Required fields are marked with *

My Review for All PRKCQ Products

Required fields are marked with *

0
cart-icon
0
compare icon