Recombinant Human PRKD1 protein, GST-tagged
| Cat.No. : | PRKD1-301474H |
| Product Overview : | Recombinant Human PRKD1 (310-395 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Lys310-Thr395 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | KRCAPKVPNNCLGEVTINGDLLSPGAESDVVMEEGSDDNDSERNSGLMDDMEEAMVQDAEMAMAECQNDSGEMQDPDPDHEDANRT |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | PRKD1 protein kinase D1 [ Homo sapiens ] |
| Official Symbol | PRKD1 |
| Synonyms | PRKD1; protein kinase D1; PRKCM, protein kinase C, mu; serine/threonine-protein kinase D1; PKC mu; PKCM; PKD; nPKC-D1; nPKC-mu; protein kinase D; protein kinase C, mu; protein kinase C mu type; PRKCM; PKC-MU; |
| Gene ID | 5587 |
| mRNA Refseq | NM_002742 |
| Protein Refseq | NP_002733 |
| MIM | 605435 |
| UniProt ID | Q15139 |
| ◆ Recombinant Proteins | ||
| PRKD1-2711H | Recombinant Human PRKD1 protein, His & T7-tagged | +Inquiry |
| PRKD1-3415H | Recombinant Human PRKD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Prkd1-5124M | Recombinant Mouse Prkd1 Protein, Myc/DDK-tagged | +Inquiry |
| PRKD1-1158H | Recombinant Human PRKD1 Protein (S2-L912), Tag Free | +Inquiry |
| PRKD1-2864C | Recombinant Chicken PRKD1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRKD1-2851HCL | Recombinant Human PRKD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRKD1 Products
Required fields are marked with *
My Review for All PRKD1 Products
Required fields are marked with *


