Recombinant Human PRKD1 protein, GST-tagged

• Cat.No.: PRKD1-301474H
• Product Overview: Recombinant Human PRKD1 (310-395 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Lys310-Thr395
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: KRCAPKVPNNCLGEVTINGDLLSPGAESDVVMEEGSDDNDSERNSGLMDDMEEAMVQDAEMAMAECQNDSGEMQDPDPDHEDANRT
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: PRKD1 protein kinase D1 [ Homo sapiens ]
• Official Symbol: PRKD1
• Synonyms: PRKD1; protein kinase D1; PRKCM, protein kinase C, mu; serine/threonine-protein kinase D1; PKC mu; PKCM; PKD; nPKC-D1; nPKC-mu; protein kinase D; protein kinase C, mu; protein kinase C mu type; PRKCM; PKC-MU
• Gene ID: 5587
• mRNA Refseq: NM_002742
• Protein Refseq: NP_002733
• MIM: 605435
• UniProt ID: Q15139