Recombinant Human PRKD1 protein, GST-tagged
Cat.No. : | PRKD1-301474H |
Product Overview : | Recombinant Human PRKD1 (310-395 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Lys310-Thr395 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | KRCAPKVPNNCLGEVTINGDLLSPGAESDVVMEEGSDDNDSERNSGLMDDMEEAMVQDAEMAMAECQNDSGEMQDPDPDHEDANRT |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | PRKD1 protein kinase D1 [ Homo sapiens ] |
Official Symbol | PRKD1 |
Synonyms | PRKD1; protein kinase D1; PRKCM, protein kinase C, mu; serine/threonine-protein kinase D1; PKC mu; PKCM; PKD; nPKC-D1; nPKC-mu; protein kinase D; protein kinase C, mu; protein kinase C mu type; PRKCM; PKC-MU; |
Gene ID | 5587 |
mRNA Refseq | NM_002742 |
Protein Refseq | NP_002733 |
MIM | 605435 |
UniProt ID | Q15139 |
◆ Recombinant Proteins | ||
Prkd1-5124M | Recombinant Mouse Prkd1 Protein, Myc/DDK-tagged | +Inquiry |
PRKD1-406H | Recombinant Human Protein Kinase D1, GST-tagged, Active | +Inquiry |
PRKD1-13372M | Recombinant Mouse PRKD1 Protein | +Inquiry |
PRKD1-5993H | Recombinant Human PRKD1 Protein (Thr651-Gln876), N-His tagged | +Inquiry |
PRKD1-2711H | Recombinant Human PRKD1 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRKD1-2851HCL | Recombinant Human PRKD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRKD1 Products
Required fields are marked with *
My Review for All PRKD1 Products
Required fields are marked with *