Recombinant Human PRKRIR Protein (612-761 aa), His-SUMO-tagged
| Cat.No. : | PRKRIR-740H |
| Product Overview : | Recombinant Human PRKRIR Protein (612-761 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 612-761 aa |
| Description : | Upstream regulator of interferon-induced serine/threonine protein kinase R (PKR). May block the PKR-inhibitory function of P58IPK, resulting in restoration of kinase activity and suppression of cell growth. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 33.6 kDa |
| AA Sequence : | MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | PRKRIR protein-kinase, interferon-inducible double stranded RNA dependent inhibitor, repressor of (P58 repressor) [ Homo sapiens ] |
| Official Symbol | PRKRIR |
| Synonyms | PRKRIR; DAP4; P52rIPK; THAP0; MGC102750; |
| Gene ID | 5612 |
| mRNA Refseq | NM_004705 |
| Protein Refseq | NP_004696 |
| MIM | 607374 |
| UniProt ID | O43422 |
| ◆ Recombinant Proteins | ||
| PRKRIR-1962H | Recombinant Human PRKRIR, His-tagged | +Inquiry |
| PRKRIR-13380M | Recombinant Mouse PRKRIR Protein | +Inquiry |
| PRKRIR-740H | Recombinant Human PRKRIR Protein (612-761 aa), His-SUMO-tagged | +Inquiry |
| PRKRIR-7103M | Recombinant Mouse PRKRIR Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRKRIR-2846HCL | Recombinant Human PRKRIR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRKRIR Products
Required fields are marked with *
My Review for All PRKRIR Products
Required fields are marked with *
