Recombinant Human PRKX
Cat.No. : | PRKX-30107TH |
Product Overview : | Recombinant fragment of Human PRKX with N terminal proprietary tag, 35.53 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 90 amino acids |
Description : | This gene encodes a serine threonine protein kinase that has similarity to the catalytic subunit of cyclic AMP dependent protein kinases. The encoded protein is developmentally regulated and may be involved in renal epithelial morphogenesis. This protein may also be involved in macrophage and granulocyte maturation. Abnormal recombination between this gene and a related pseudogene on chromosome Y is a frequent cause of sex reversal disorder in XX males and XY females. Pseudogenes of this gene are found on chromosomes X, 15 and Y. |
Molecular Weight : | 35.530kDa inclusive of tags |
Tissue specificity : | High levels in adult and fetal brain, kidney and lung; low levels in adult placenta, heart, liver, skeletal muscle, pancreas and fetal liver. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FHVKDLIKKLLVVDRTRRLGNMKNGANDVKHHRWFRSVDWEAVPQRKLKPPIVPKIAGDGDTSNFETYPENDWDTAAPVPQKDLEIFKNF |
Sequence Similarities : | Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. cAMP subfamily.Contains 1 AGC-kinase C-terminal domain.Contains 1 protein kinase domain. |
Gene Name | PRKX protein kinase, X-linked [ Homo sapiens ] |
Official Symbol | PRKX |
Synonyms | PRKX; protein kinase, X-linked; cAMP-dependent protein kinase catalytic subunit PRKX; PKX1; |
Gene ID | 5613 |
mRNA Refseq | NM_005044 |
Protein Refseq | NP_005035 |
MIM | 300083 |
Uniprot ID | P51817 |
Chromosome Location | Xp22.3 |
Pathway | Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Bile secretion, organism-specific biosystem; |
Function | ATP binding; cAMP-dependent protein kinase activity; nucleotide binding; protein binding; protein serine/threonine kinase activity; |
◆ Recombinant Proteins | ||
PRKX-3428R | Recombinant Rhesus Macaque PRKX Protein, His (Fc)-Avi-tagged | +Inquiry |
PRKX-1100H | Recombinant Human PRKX Protein (M1-F358), Tag Free | +Inquiry |
PRKX-1963H | Recombinant Human PRKX, GST-tagged | +Inquiry |
PRKX-1101H | Recombinant Human PRKX Protein (M1-F358), GST tagged | +Inquiry |
PRKX-3610R | Recombinant Rhesus monkey PRKX Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRKX-2845HCL | Recombinant Human PRKX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRKX Products
Required fields are marked with *
My Review for All PRKX Products
Required fields are marked with *