Recombinant Human PRLR Full Length Transmembrane protein, His&Myc-tagged
Cat.No. : | PRLR-2391H |
Product Overview : | Recombinant Human PRLR protein(P16471)(25-622aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 25-622aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 71.9kDa |
AA Sequence : | QLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PRLR prolactin receptor [ Homo sapiens ] |
Official Symbol | PRLR |
Synonyms | PRLR; prolactin receptor; PRL-R; hPRL receptor; secreted prolactin binding protein; hPRLrI; |
Gene ID | 5618 |
mRNA Refseq | NM_000949 |
Protein Refseq | NP_000940 |
MIM | 176761 |
UniProt ID | P16471 |
◆ Recombinant Proteins | ||
PRLR-4144H | Active Recombinant Human Prolactin Receptor | +Inquiry |
PRLR-2723HCL | Recombinant Human PRLR HEK293T cell lysate | +Inquiry |
RFL11347RF | Recombinant Full Length Rat Prolactin Receptor(Prlr) Protein, His-Tagged | +Inquiry |
Prlr -100R | Recombinant Rat Prolactin Receptor, chiMAX Fc Fusion Protein | +Inquiry |
PRLR-2391H | Recombinant Human PRLR Full Length Transmembrane protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRLR-1740RCL | Recombinant Rat PRLR cell lysate | +Inquiry |
PRLR-2722HCL | Recombinant Human PRLR cell lysate | +Inquiry |
PRLR-1451MCL | Recombinant Mouse PRLR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRLR Products
Required fields are marked with *
My Review for All PRLR Products
Required fields are marked with *
0
Inquiry Basket