Recombinant Human PRMT1 Protein, GST-tagged

Cat.No. : PRMT1-5041H
Product Overview : Human HRMT1L2 partial ORF ( NP_001527, 260 a.a. - 361 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The PRMT1 gene encodes a protein arginine methyltransferase that functions as a histone methyltransferase specific for H4 (see MIM 602822).[supplied by OMIM
Molecular Mass : 36.96 kDa
AA Sequence : PFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PRMT1 protein arginine methyltransferase 1 [ Homo sapiens ]
Official Symbol PRMT1
Synonyms PRMT1; protein arginine methyltransferase 1; HMT1 (hnRNP methyltransferase, S. cerevisiae) like 2 , HMT1 hnRNP methyltransferase like 2 (S. cerevisiae) , HRMT1L2; protein arginine N-methyltransferase 1; ANM1; HCP1; interferon receptor 1-bound protein 4; histone-arginine N-methyltransferase PRMT1; HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 2; heterogeneous nuclear ribonucleoprotein methyltransferase 1-like 2; IR1B4; HRMT1L2;
Gene ID 3276
mRNA Refseq NM_001207042
Protein Refseq NP_001193971
MIM 602950
UniProt ID Q99873

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRMT1 Products

Required fields are marked with *

My Review for All PRMT1 Products

Required fields are marked with *

0
cart-icon