Recombinant Human PRMT1 Protein, GST-tagged
Cat.No. : | PRMT1-5041H |
Product Overview : | Human HRMT1L2 partial ORF ( NP_001527, 260 a.a. - 361 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The PRMT1 gene encodes a protein arginine methyltransferase that functions as a histone methyltransferase specific for H4 (see MIM 602822).[supplied by OMIM |
Molecular Mass : | 36.96 kDa |
AA Sequence : | PFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PRMT1 protein arginine methyltransferase 1 [ Homo sapiens ] |
Official Symbol | PRMT1 |
Synonyms | PRMT1; protein arginine methyltransferase 1; HMT1 (hnRNP methyltransferase, S. cerevisiae) like 2 , HMT1 hnRNP methyltransferase like 2 (S. cerevisiae) , HRMT1L2; protein arginine N-methyltransferase 1; ANM1; HCP1; interferon receptor 1-bound protein 4; histone-arginine N-methyltransferase PRMT1; HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 2; heterogeneous nuclear ribonucleoprotein methyltransferase 1-like 2; IR1B4; HRMT1L2; |
Gene ID | 3276 |
mRNA Refseq | NM_001207042 |
Protein Refseq | NP_001193971 |
MIM | 602950 |
UniProt ID | Q99873 |
◆ Recombinant Proteins | ||
PRMT1-309HFL | Active Recombinant Full Length Human PRMT1 Protein, C-Flag-tagged | +Inquiry |
PRMT1-5041H | Recombinant Human PRMT1 Protein, GST-tagged | +Inquiry |
PRMT1-31112TH | Active Recombinant Human PRMT1 protein, GST-tagged | +Inquiry |
PRMT1-3411H | Recombinant Human PRMT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRMT1-1967H | Recombinant Human PRMT1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRMT1-500HCL | Recombinant Human PRMT1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRMT1 Products
Required fields are marked with *
My Review for All PRMT1 Products
Required fields are marked with *