Recombinant Human PRMT1 Protein, GST-tagged
| Cat.No. : | PRMT1-5041H |
| Product Overview : | Human HRMT1L2 partial ORF ( NP_001527, 260 a.a. - 361 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The PRMT1 gene encodes a protein arginine methyltransferase that functions as a histone methyltransferase specific for H4 (see MIM 602822).[supplied by OMIM |
| Molecular Mass : | 36.96 kDa |
| AA Sequence : | PFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | PRMT1 protein arginine methyltransferase 1 [ Homo sapiens ] |
| Official Symbol | PRMT1 |
| Synonyms | PRMT1; protein arginine methyltransferase 1; HMT1 (hnRNP methyltransferase, S. cerevisiae) like 2 , HMT1 hnRNP methyltransferase like 2 (S. cerevisiae) , HRMT1L2; protein arginine N-methyltransferase 1; ANM1; HCP1; interferon receptor 1-bound protein 4; histone-arginine N-methyltransferase PRMT1; HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 2; heterogeneous nuclear ribonucleoprotein methyltransferase 1-like 2; IR1B4; HRMT1L2; |
| Gene ID | 3276 |
| mRNA Refseq | NM_001207042 |
| Protein Refseq | NP_001193971 |
| MIM | 602950 |
| UniProt ID | Q99873 |
| ◆ Recombinant Proteins | ||
| Prmt1-7228M | Active Recombinant Mouse Prmt1 Protein, His-MBP-tagged | +Inquiry |
| PRMT1-016H | Recombinant Human PRMT1 Protein, GST-tagged | +Inquiry |
| PRMT1-123H | Recombinant Human PRMT1 protein, T7/His-tagged | +Inquiry |
| Prmt1-1171M | Recombinant Mouse Prmt1 Protein, MYC/DDK-tagged | +Inquiry |
| PRMT1-1967H | Recombinant Human PRMT1, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRMT1-500HCL | Recombinant Human PRMT1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRMT1 Products
Required fields are marked with *
My Review for All PRMT1 Products
Required fields are marked with *
