"PRMT1" Related Products

Expand
Expand

Recombinant Human PRMT1 protein, T7/His-tagged

Cat.No.: PRMT1-123H
Product Overview: Recombinant human PRMT1 cDNA (371 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDM TSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSI SDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRAT LYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFC LQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDL DFTIDLDFKGQLCELSCSTDYRMR
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: PRMT1 protein arginine methyltransferase 1 [ Homo sapiens ]
Official Symbol: PRMT1
Synonyms: PRMT1; protein arginine methyltransferase 1; HMT1 (hnRNP methyltransferase, S. cerevisiae) like 2 , HMT1 hnRNP methyltransferase like 2 (S. cerevisiae) , HRMT1L2; protein arginine N-methyltransferase 1; ANM1; HCP1; interferon receptor 1-bound protein 4; histone-arginine N-methyltransferase PRMT1; HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 2; heterogeneous nuclear ribonucleoprotein methyltransferase 1-like 2; IR1B4; HRMT1L2;
Gene ID: 3276
mRNA Refseq: NM_001207042
Protein Refseq: NP_001193971
MIM: 602950
UniProt ID: Q99873
Chromosome Location: 19q13
Pathway: Androgen Receptor Signaling Pathway, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; Energy Metabolism, organism-specific biosystem; Tryptophan metabolism, organism-specific biosystem; mRNA processing, organism-specific biosystem;
Function: N-methyltransferase activity; N-methyltransferase activity; histone methyltransferase activity; histone methyltransferase activity (H4-R3 specific); methyltransferase activity; protein binding; transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.