Recombinant Human PRMT2, His-tagged
Cat.No. : | PRMT2-31115TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 286-433 of Human PRMT2 with an N terminal His tag. Predicted MWt: 18 kDa; |
- Specification
- Gene Information
- Related Products
Description : | Protein arginine N-methyltransferase 2 is an enzyme that in humans is encoded by the PRMT2 gene. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Ubiquitous. |
Form : | Lyophilised:Reconstitute with 102 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGE LRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGP FHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVW RRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR |
Sequence Similarities : | Belongs to the protein arginine N-methyltransferase family.Contains 1 SH3 domain. |
Gene Name : | PRMT2 protein arginine methyltransferase 2 [ Homo sapiens ] |
Official Symbol : | PRMT2 |
Synonyms : | PRMT2; protein arginine methyltransferase 2; HMT1 (hnRNP methyltransferase, S. cerevisiae) like 1 , HMT1 hnRNP methyltransferase like 1 (S. cerevisiae) , HRMT1L1; protein arginine N-methyltransferase 2; MGC111373; |
Gene ID : | 3275 |
mRNA Refseq : | NM_001242864 |
Protein Refseq : | NP_001229793 |
MIM : | 601961 |
Uniprot ID : | P55345 |
Chromosome Location : | 21q22.3 |
Pathway : | mRNA processing, organism-specific biosystem; |
Function : | androgen receptor binding; estrogen receptor binding; estrogen receptor binding; histone methyltransferase activity; histone-arginine N-methyltransferase activity; |
Products Types
◆ Recombinant Protein | ||
Prmt2-1170M | Recombinant Mouse Prmt2 Protein, MYC/DDK-tagged | +Inquiry |
PRMT2-3431R | Recombinant Rhesus Macaque PRMT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRMT2-5034Z | Recombinant Zebrafish PRMT2 | +Inquiry |
PRMT2-3251H | Recombinant Human PRMT2 protein, His-tagged | +Inquiry |
PRMT2-3613R | Recombinant Rhesus monkey PRMT2 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
PRMT2-2839HCL | Recombinant Human PRMT2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket