Recombinant Human PRMT2, His-tagged
| Cat.No. : | PRMT2-31115TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 286-433 of Human PRMT2 with an N terminal His tag. Predicted MWt: 18 kDa; |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 286-433 a.a. |
| Description : | Protein arginine N-methyltransferase 2 is an enzyme that in humans is encoded by the PRMT2 gene. |
| Conjugation : | HIS |
| Tissue specificity : | Ubiquitous. |
| Form : | Lyophilised:Reconstitute with 102 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | SKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGE LRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGP FHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVW RRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR |
| Sequence Similarities : | Belongs to the protein arginine N-methyltransferase family.Contains 1 SH3 domain. |
| Gene Name | PRMT2 protein arginine methyltransferase 2 [ Homo sapiens ] |
| Official Symbol | PRMT2 |
| Synonyms | PRMT2; protein arginine methyltransferase 2; HMT1 (hnRNP methyltransferase, S. cerevisiae) like 1 , HMT1 hnRNP methyltransferase like 1 (S. cerevisiae) , HRMT1L1; protein arginine N-methyltransferase 2; MGC111373; |
| Gene ID | 3275 |
| mRNA Refseq | NM_001242864 |
| Protein Refseq | NP_001229793 |
| MIM | 601961 |
| Uniprot ID | P55345 |
| Chromosome Location | 21q22.3 |
| Pathway | mRNA processing, organism-specific biosystem; |
| Function | androgen receptor binding; estrogen receptor binding; estrogen receptor binding; histone methyltransferase activity; histone-arginine N-methyltransferase activity; |
| ◆ Recombinant Proteins | ||
| PRMT2-3613R | Recombinant Rhesus monkey PRMT2 Protein, His-tagged | +Inquiry |
| PRMT2-02H | Recombinant Human PRMT2 Protein, transcript variant 1, C-Flag-tagged | +Inquiry |
| PRMT2-634HF | Recombinant Full Length Human PRMT2 Protein, GST-tagged | +Inquiry |
| PRMT2-3431R | Recombinant Rhesus Macaque PRMT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRMT2-12H | Recombinant Full Length Human PRMT2 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRMT2-2839HCL | Recombinant Human PRMT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRMT2 Products
Required fields are marked with *
My Review for All PRMT2 Products
Required fields are marked with *
