Recombinant Human PRMT2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PRMT2-5188H
• Product Overview: PRMT2 MS Standard C13 and N15-labeled recombinant protein (NP_001526) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. Acts as a coactivator (with NCOA2) of the androgen receptor (AR)-mediated transactivation. Acts as a coactivator (with estrogen) of estrogen receptor (ER)-mediated transactivation. Enhances PGR, PPARG, RARA-mediated transactivation. May inhibit NF-kappa-B transcription and promote apoptosis. Represses E2F1 transcriptional activity (in a RB1-dependent manner). May be involved in growth regulation.
• Molecular Mass: 48.9 kDa
• AA Sequence: MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPTSQKVGEKVFPIWRSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PRMT2 protein arginine methyltransferase 2 [ Homo sapiens (human) ]
• Official Symbol: PRMT2
• Synonyms: PRMT2; protein arginine methyltransferase 2; HMT1 (hnRNP methyltransferase, S. cerevisiae) like 1, HMT1 hnRNP methyltransferase like 1 (S. cerevisiae), HRMT1L1; protein arginine N-methyltransferase 2; MGC111373; PRMT2 beta; PRMT2 alpha; PRMT2 gamma; HMT1 hnRNP methyltransferase-like 1; histone-arginine N-methyltransferase PRMT2; HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1; HRMT1L1
• Gene ID: 3275
• mRNA Refseq: NM_001535
• Protein Refseq: NP_001526
• MIM: 601961
• UniProt ID: P55345