"PRMT8" Related Products

Expand

Recombinant Human PRMT8 Protein, GST-tagged

Cat.No. : PRMT8-5043H
Product Overview : Human HRMT1L4 partial ORF ( NP_062828, 235 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal.
Description : Arginine methylation is a widespread posttranslational modification mediated by arginine methyltransferases, such as PRMT8. Arginine methylation is involved in a number of cellular processes, including DNA repair, RNA transcription, signal transduction, protein compartmentalization, and possibly protein translation (Lee et al., 2005 [PubMed 16051612]).[supplied by OMIM
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 36.74 kDa
AA Sequence : CLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : PRMT8 protein arginine methyltransferase 8 [ Homo sapiens ]
Official Symbol : PRMT8
Synonyms : PRMT8; protein arginine methyltransferase 8; HMT1 hnRNP methyltransferase like 3 (S. cerevisiae) , HMT1 hnRNP methyltransferase like 4 (S. cerevisiae) , HRMT1L3, HRMT1L4; protein arginine N-methyltransferase 8; HMT1 hnRNP methyltransferase-like 3; protein arginine N-methyltransferase 4; heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4; HRMT1L3; HRMT1L4;
Gene ID : 56341
mRNA Refseq : NM_001256536
Protein Refseq : NP_001243465
MIM : 610086
UniProt ID : Q9NR22

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.