Recombinant Human PRMT8 Protein, GST-tagged
| Cat.No. : | PRMT8-5043H |
| Product Overview : | Human HRMT1L4 partial ORF ( NP_062828, 235 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Arginine methylation is a widespread posttranslational modification mediated by arginine methyltransferases, such as PRMT8. Arginine methylation is involved in a number of cellular processes, including DNA repair, RNA transcription, signal transduction, protein compartmentalization, and possibly protein translation (Lee et al., 2005 [PubMed 16051612]).[supplied by OMIM |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | CLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | PRMT8 protein arginine methyltransferase 8 [ Homo sapiens ] |
| Official Symbol | PRMT8 |
| Synonyms | PRMT8; protein arginine methyltransferase 8; HMT1 hnRNP methyltransferase like 3 (S. cerevisiae) , HMT1 hnRNP methyltransferase like 4 (S. cerevisiae) , HRMT1L3, HRMT1L4; protein arginine N-methyltransferase 8; HMT1 hnRNP methyltransferase-like 3; protein arginine N-methyltransferase 4; heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4; HRMT1L3; HRMT1L4; |
| Gene ID | 56341 |
| mRNA Refseq | NM_001256536 |
| Protein Refseq | NP_001243465 |
| MIM | 610086 |
| UniProt ID | Q9NR22 |
| ◆ Recombinant Proteins | ||
| PRMT8-126H | Recombinant Human PRMT8 Protein, GST-tagged | +Inquiry |
| PRMT8-004H | Recombinant Human PRMT8 Protein, GST-tagged | +Inquiry |
| Prmt8-5136M | Recombinant Mouse Prmt8 Protein, Myc/DDK-tagged | +Inquiry |
| PRMT8-13422M | Recombinant Mouse PRMT8 Protein | +Inquiry |
| PRMT8-7128M | Recombinant Mouse PRMT8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRMT8-2837HCL | Recombinant Human PRMT8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRMT8 Products
Required fields are marked with *
My Review for All PRMT8 Products
Required fields are marked with *
