Recombinant Human PRMT8 Protein, GST-tagged

Cat.No. : PRMT8-5043H
Product Overview : Human HRMT1L4 partial ORF ( NP_062828, 235 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Arginine methylation is a widespread posttranslational modification mediated by arginine methyltransferases, such as PRMT8. Arginine methylation is involved in a number of cellular processes, including DNA repair, RNA transcription, signal transduction, protein compartmentalization, and possibly protein translation (Lee et al., 2005 [PubMed 16051612]).[supplied by OMIM
Molecular Mass : 36.74 kDa
AA Sequence : CLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PRMT8 protein arginine methyltransferase 8 [ Homo sapiens ]
Official Symbol PRMT8
Synonyms PRMT8; protein arginine methyltransferase 8; HMT1 hnRNP methyltransferase like 3 (S. cerevisiae) , HMT1 hnRNP methyltransferase like 4 (S. cerevisiae) , HRMT1L3, HRMT1L4; protein arginine N-methyltransferase 8; HMT1 hnRNP methyltransferase-like 3; protein arginine N-methyltransferase 4; heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4; HRMT1L3; HRMT1L4;
Gene ID 56341
mRNA Refseq NM_001256536
Protein Refseq NP_001243465
MIM 610086
UniProt ID Q9NR22

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRMT8 Products

Required fields are marked with *

My Review for All PRMT8 Products

Required fields are marked with *

0
cart-icon
0
compare icon