Recombinant Human PRNP Protein, Lys23-Ser230, C-His-Avi tagged, Biotinylated
Cat.No. : | PRNP-12HB |
Product Overview : | Biotinylated recombinant Human PRNP Protein (Lys23-Ser230) with C-His-Avi tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Avi&His |
Protein Length : | Lys23-Ser230 |
Description : | The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that tends to aggregate into rod-like structures. The encoded protein contains a highly unstable region of five tandem octapeptide repeats. This gene is found on chromosome 20, approximately 20 kbp upstream of a gene which encodes a biochemically and structurally similar protein to the one encoded by this gene. Mutations in the repeat region as well as elsewhere in this gene have been associated with Creutzfeldt-Jakob disease, fatal familial insomnia, Gerstmann-Straussler disease, Huntington disease-like 1, and kuru. An overlapping open reading frame has been found for this gene that encodes a smaller, structurally unrelated protein, AltPrp. Alternative splicing results in multiple transcript variants. |
Conjugation/Label : | Biotin |
Molecular Mass : | 25 kDa |
AA Sequence : | KKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSHHHHHHHHGLNDIFEAQKIEWHE |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.42 mg/mL by Bradford |
Storage Buffer : | Sterile 50mM tris, pH8.0, 300mM NaCl, 2mM DTT, 0.01% SKL, 20% Glycerol |
Gene Name | PRNP prion protein (Kanno blood group) [ Homo sapiens (human) ] |
Official Symbol | PRNP |
Synonyms | PRNP; prion protein (Kanno blood group); CJD; GSS; PrP; ASCR; KURU; PRIP; PrPc; CD230; AltPrP; p27-30; PrP27-30; PrP33-35C; major prion protein; alternative prion protein; CD230 antigen; prion-related protein |
Gene ID | 5621 |
mRNA Refseq | NM_000311 |
Protein Refseq | NP_000302 |
MIM | 176640 |
UniProt ID | P04156 |
◆ Recombinant Proteins | ||
PRNP-40C | Recombinant Cervus elaphus PRNP Protein, His-tagged | +Inquiry |
Prnp-799B | Recombinant Bovine Prion Protein, His-tagged | +Inquiry |
PRNP-373H | Recombinant Human PRNP, Fc-tagged | +Inquiry |
PRNP-7129M | Recombinant Mouse PRNP Protein, His (Fc)-Avi-tagged | +Inquiry |
PRNP-789H | Recombinant Human Prion Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRNP-001HCL | Recombinant Human PRNP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRNP Products
Required fields are marked with *
My Review for All PRNP Products
Required fields are marked with *
0
Inquiry Basket