Recombinant Human PRNP Protein, Lys23-Ser230, C-His-Avi tagged, Biotinylated

Cat.No. : PRNP-12HB
Product Overview : Biotinylated recombinant Human PRNP Protein (Lys23-Ser230) with C-His-Avi tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Avi&His
Protein Length : Lys23-Ser230
Description : The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that tends to aggregate into rod-like structures. The encoded protein contains a highly unstable region of five tandem octapeptide repeats. This gene is found on chromosome 20, approximately 20 kbp upstream of a gene which encodes a biochemically and structurally similar protein to the one encoded by this gene. Mutations in the repeat region as well as elsewhere in this gene have been associated with Creutzfeldt-Jakob disease, fatal familial insomnia, Gerstmann-Straussler disease, Huntington disease-like 1, and kuru. An overlapping open reading frame has been found for this gene that encodes a smaller, structurally unrelated protein, AltPrp. Alternative splicing results in multiple transcript variants.
Conjugation/Label : Biotin
Molecular Mass : 25 kDa
AA Sequence : KKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSHHHHHHHHGLNDIFEAQKIEWHE
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.42 mg/mL by Bradford
Storage Buffer : Sterile 50mM tris, pH8.0, 300mM NaCl, 2mM DTT, 0.01% SKL, 20% Glycerol
Gene Name PRNP prion protein (Kanno blood group) [ Homo sapiens (human) ]
Official Symbol PRNP
Synonyms PRNP; prion protein (Kanno blood group); CJD; GSS; PrP; ASCR; KURU; PRIP; PrPc; CD230; AltPrP; p27-30; PrP27-30; PrP33-35C; major prion protein; alternative prion protein; CD230 antigen; prion-related protein
Gene ID 5621
mRNA Refseq NM_000311
Protein Refseq NP_000302
MIM 176640
UniProt ID P04156

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRNP Products

Required fields are marked with *

My Review for All PRNP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon