Recombinant Human PROC therapeutic protein(Drotrecogin alfa)

• Cat.No.: PROC-P027H
• Product Overview: Recombinant Human activated protein C therapeutic protein is synthesized by recombinant DNA technology. It is a glycoprotein of approximately 55 kilodalton molecular weight, consisting of a heavy chain and a light chain linked by a disulfide bond.

Specification

• Species: Human
• Tag: Non
• Description: This gene encodes a vitamin K-dependent plasma glycoprotein. The encoded protein is cleaved to its activated form by the thrombin-thrombomodulin complex. This activated form contains a serine protease domain and functions in degradation of the activated forms of coagulation factors V and VIII. Mutations in this gene have been associated with thrombophilia due to protein C deficiency, neonatal purpura fulminans, and recurrent venous thrombosis.
• Molecular Mass: 55000
• AA Sequence: >Heavy chainLIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP>Light chainSKHVDGDQCLVLPLEHPCASLCCGHGTCIXGIGSFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSHL
• Endotoxin: < 0.1 EU per μg of the protein
• Purity: >95%
• Alias: PROC; PC; APC; PROC1; THPH3; THPH4; Drotrecogin alfa

Gene Information

• Gene Name: PROC protein C (inactivator of coagulation factors Va and VIIIa) [ Homo sapiens ]
• Official Symbol: PROC
• Synonyms: PROC; protein C (inactivator of coagulation factors Va and VIIIa); vitamin K-dependent protein C; autoprothrombin IIA; anticoagulant protein C; blood coagulation factor XIV; PC; APC; PROC1; THPH3; THPH4
• Gene ID: 5624
• mRNA Refseq: NM_000312
• Protein Refseq: NP_000303
• MIM: 612283
• UniProt ID: P04070
• Chromosome Location: 2q13-q14
• Pathway: Cell surface interactions at the vascular wall, organism-specific biosystem; Common Pathway, organism-specific biosystem; Complement and Coagulation Cascades, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Formation of Fibrin Clot (Clotting Cascade), organism-specific biosystem; Gamma-carboxylation of protein precursors, organism-specific biosystem
• Function: calcium ion binding; peptidase activity; protein binding; serine-type endopeptidase activity