Recombinant Human PROC therapeutic protein(Drotrecogin alfa)
Cat.No. : | PROC-P027H |
Product Overview : | Recombinant Human activated protein C therapeutic protein is synthesized by recombinant DNA technology. It is a glycoprotein of approximately 55 kilodalton molecular weight, consisting of a heavy chain and a light chain linked by a disulfide bond. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Description : | This gene encodes a vitamin K-dependent plasma glycoprotein. The encoded protein is cleaved to its activated form by the thrombin-thrombomodulin complex. This activated form contains a serine protease domain and functions in degradation of the activated forms of coagulation factors V and VIII. Mutations in this gene have been associated with thrombophilia due to protein C deficiency, neonatal purpura fulminans, and recurrent venous thrombosis. |
Molecular Mass : | 55000 |
AA Sequence : | >Heavy chainLIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP>Light chainSKHVDGDQCLVLPLEHPCASLCCGHGTCIXGIGSFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSHL |
Endotoxin : | < 0.1 EU per μg of the protein |
Purity : | >95% |
Alias : | PROC; PC; APC; PROC1; THPH3; THPH4; Drotrecogin alfa |
Gene Name | PROC protein C (inactivator of coagulation factors Va and VIIIa) [ Homo sapiens ] |
Official Symbol | PROC |
Synonyms | PROC; protein C (inactivator of coagulation factors Va and VIIIa); vitamin K-dependent protein C; autoprothrombin IIA; anticoagulant protein C; blood coagulation factor XIV; PC; APC; PROC1; THPH3; THPH4; |
Gene ID | 5624 |
mRNA Refseq | NM_000312 |
Protein Refseq | NP_000303 |
MIM | 612283 |
UniProt ID | P04070 |
Chromosome Location | 2q13-q14 |
Pathway | Cell surface interactions at the vascular wall, organism-specific biosystem; Common Pathway, organism-specific biosystem; Complement and Coagulation Cascades, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Formation of Fibrin Clot (Clotting Cascade), organism-specific biosystem; Gamma-carboxylation of protein precursors, organism-specific biosystem; |
Function | calcium ion binding; peptidase activity; protein binding; serine-type endopeptidase activity; |
◆ Recombinant Proteins | ||
Proc-826M | Recombinant Mouse Proc protein, His & GST-tagged | +Inquiry |
PROC-1772H | Recombinant Human PROC Protein, His (Fc)-Avi-tagged | +Inquiry |
PROC-3505H | Recombinant Human PROC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Proc-26M | Active Recombinant Mouse Proc protein, His-tagged | +Inquiry |
PROC-4709R | Recombinant Rat PROC Protein | +Inquiry |
◆ Native Proteins | ||
PROC-64H | Active Native Human Activated Protein C | +Inquiry |
PROC-273B | Active Native Bovine Protein C - DEGR (active site blocked) | +Inquiry |
PROC-272B | Active Native Bovine Activated Protein C | +Inquiry |
Proc-5346M | Native Mouse Protein C | +Inquiry |
PROC-269B | Active Native Bovine Protein C | +Inquiry |
◆ Cell & Tissue Lysates | ||
PROC-747MCL | Recombinant Mouse PROC cell lysate | +Inquiry |
PROC-852HCL | Recombinant Human PROC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PROC Products
Required fields are marked with *
My Review for All PROC Products
Required fields are marked with *
0
Inquiry Basket