Recombinant Human PROC therapeutic protein(Drotrecogin alfa)

Cat.No. : PROC-P027H
Product Overview : Recombinant Human activated protein C therapeutic protein is synthesized by recombinant DNA technology. It is a glycoprotein of approximately 55 kilodalton molecular weight, consisting of a heavy chain and a light chain linked by a disulfide bond.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Non
Description : This gene encodes a vitamin K-dependent plasma glycoprotein. The encoded protein is cleaved to its activated form by the thrombin-thrombomodulin complex. This activated form contains a serine protease domain and functions in degradation of the activated forms of coagulation factors V and VIII. Mutations in this gene have been associated with thrombophilia due to protein C deficiency, neonatal purpura fulminans, and recurrent venous thrombosis.
Molecular Mass : 55000
AA Sequence : >Heavy chainLIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP>Light chainSKHVDGDQCLVLPLEHPCASLCCGHGTCIXGIGSFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSHL
Endotoxin : < 0.1 EU per μg of the protein
Purity : >95%
Alias : PROC; PC; APC; PROC1; THPH3; THPH4; Drotrecogin alfa
Gene Name PROC protein C (inactivator of coagulation factors Va and VIIIa) [ Homo sapiens ]
Official Symbol PROC
Synonyms PROC; protein C (inactivator of coagulation factors Va and VIIIa); vitamin K-dependent protein C; autoprothrombin IIA; anticoagulant protein C; blood coagulation factor XIV; PC; APC; PROC1; THPH3; THPH4;
Gene ID 5624
mRNA Refseq NM_000312
Protein Refseq NP_000303
MIM 612283
UniProt ID P04070
Chromosome Location 2q13-q14
Pathway Cell surface interactions at the vascular wall, organism-specific biosystem; Common Pathway, organism-specific biosystem; Complement and Coagulation Cascades, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Formation of Fibrin Clot (Clotting Cascade), organism-specific biosystem; Gamma-carboxylation of protein precursors, organism-specific biosystem;
Function calcium ion binding; peptidase activity; protein binding; serine-type endopeptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PROC Products

Required fields are marked with *

My Review for All PROC Products

Required fields are marked with *

0
cart-icon