Recombinant human Proinsulin HIP 11, His-tagged
| Cat.No. : | HIP11-01H |
| Product Overview : | Recombinant human Proinsulin HIP 11, fused to His tag, was expressed in E. coli. |
| Availability | August 11, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Form : | PBS buffer, pH 7.4 |
| Molecular Mass : | ~13.35 kDa |
| AA Sequence : | MFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEAEDLQVGQVELGGGPGAGSLQPLALEGSLQEGSLQKRGIVEQCCTSICSLYQLENYCNHHHHHH |
| Purity : | >90 % as determined by SDS-PAGE |
| Storage : | Long Term Storage at -20°C to -80°C. Avoid freeze/thaw cycles. |
| Concentration : | 0.3 ug/ul |
| ◆ Recombinant Proteins | ||
| HIP11-01H | Recombinant human Proinsulin HIP 11, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HIP11 Products
Required fields are marked with *
My Review for All HIP11 Products
Required fields are marked with *



